USER         PID %CPU %MEM    VSZ   RSS TTY      STAT START   TIME COMMAND
ubuntu     50791 17.1  2.9 13959984 1937504 ?    Ssl  15:23  13:02 mysqld --wsrep_start_position=3c49b69b-be75-11f1-8c52-d6db722c591a:20
root       42343 19.5  2.8 3106664 1886496 ?     Ssl  15:20  15:25 kube-apiserver --advertise-address=199.204.45.20 --allow-privileged=true --authorization-mode=Node,RBAC --client-ca-file=/etc/kubernetes/pki/ca.crt --enable-admission-plugins=NodeRestriction --enable-bootstrap-token-auth=true --etcd-cafile=/etc/kubernetes/pki/etcd/ca.crt --etcd-certfile=/etc/kubernetes/pki/apiserver-etcd-client.crt --etcd-keyfile=/etc/kubernetes/pki/apiserver-etcd-client.key --etcd-servers=https://127.0.0.1:2379 --kubelet-client-certificate=/etc/kubernetes/pki/apiserver-kubelet-client.crt --kubelet-client-key=/etc/kubernetes/pki/apiserver-kubelet-client.key --kubelet-preferred-address-types=InternalIP,ExternalIP,Hostname --proxy-client-cert-file=/etc/kubernetes/pki/front-proxy-client.crt --proxy-client-key-file=/etc/kubernetes/pki/front-proxy-client.key --requestheader-allowed-names=front-proxy-client --requestheader-client-ca-file=/etc/kubernetes/pki/front-proxy-ca.crt --requestheader-extra-headers-prefix=X-Remote-Extra- --requestheader-group-headers=X-Remote-Group --requestheader-username-headers=X-Remote-User --secure-port=6443 --service-account-issuer=https://kubernetes.default.svc.cluster.local --service-account-key-file=/etc/kubernetes/pki/sa.pub --service-account-signing-key-file=/etc/kubernetes/pki/sa.key --service-cluster-ip-range=10.96.0.0/12 --tls-cert-file=/etc/kubernetes/pki/apiserver.crt --tls-min-version=VersionTLS13 --tls-private-key-file=/etc/kubernetes/pki/apiserver.key
zuul       68785  5.0  1.4 2323944 942056 ?      Ssl  15:30   3:29 /bin/prometheus --web.console.templates=/etc/prometheus/consoles --web.console.libraries=/etc/prometheus/console_libraries --config.file=/etc/prometheus/config_out/prometheus.env.yaml --web.enable-lifecycle --web.external-url=http://prometheus.199-204-45-20.nip.io/ --web.route-prefix=/ --storage.tsdb.retention.time=10d --storage.tsdb.path=/prometheus --storage.tsdb.wal-compression --web.config.file=/etc/prometheus/web_config/web-config.yaml
167        12984  1.9  0.8 4246936 570700 ?      Sl   15:13   1:40 /usr/bin/ceph-mgr -n mgr.instance.osyhqi -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
42424     155435  0.7  0.7 1941116 499408 ?      SLl  15:49   0:24 /usr/sbin/ovs-vswitchd unix:/run/openvswitch/db.sock -vconsole:emer -vconsole:err -vconsole:info --pidfile=/run/openvswitch/ovs-vswitchd.pid --user=openvswitch:openvswitch --mlockall
zuul       53203  2.1  0.7 3838548 475360 ?      Ssl  15:24   1:37 java -Dkc.config.built=true -XX:MetaspaceSize=96M -XX:MaxMetaspaceSize=256m -Dfile.encoding=UTF-8 -Dsun.stdout.encoding=UTF-8 -Dsun.err.encoding=UTF-8 -Dstdout.encoding=UTF-8 -Dstderr.encoding=UTF-8 -XX:+ExitOnOutOfMemoryError -Djava.security.egd=file:/dev/urandom -XX:+UseParallelGC -XX:GCTimeRatio=4 -XX:AdaptiveSizePolicyWeight=90 -XX:FlightRecorderOptions=stackdepth=512 -XX:MinHeapFreeRatio=10 -XX:MaxHeapFreeRatio=20 -XX:MaxRAMPercentage=70 -XX:MinRAMPercentage=70 -XX:InitialRAMPercentage=50 --add-opens=java.base/java.util=ALL-UNNAMED --add-opens=java.base/java.util.concurrent=ALL-UNNAMED --add-opens=java.base/java.security=ALL-UNNAMED -Djgroups.dns.query=keycloak-headless.auth-system.svc.cluster.local -Dkc.home.dir=/opt/keycloak/bin/.. -Djboss.server.config.dir=/opt/keycloak/bin/../conf -Djava.util.logging.manager=org.jboss.logmanager.LogManager -Dpicocli.disable.closures=true -Dquarkus-log-max-startup-records=10000 -cp /opt/keycloak/bin/../lib/quarkus-run.jar io.quarkus.bootstrap.runner.QuarkusEntryPoint --verbose start --health-enabled=true --http-enabled=true --http-port=8080 --hostname-strict=false --spi-events-listener-jboss-logging-success-level=info --spi-events-listener-jboss-logging-error-level=warn --transaction-xa-enabled=false --metrics-enabled=true
42424      75149  0.0  0.5 607672 348784 ?       Ss   15:32   0:00 apache2 -DFOREGROUND
root        9964 22.5  0.4 3934576 318412 ?      Ssl  15:12  19:39 /usr/bin/containerd --config /etc/containerd/config.toml
167        30293  1.0  0.4 808348 307604 ?       Sl   15:17   0:49 /usr/bin/ceph-osd -n osd.1 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
42424     183631  5.5  0.4 2151448 292208 ?      Sl   15:56   2:25 neutron-api: uWSGI worker 1
42424     183632  5.2  0.4 2144836 285612 ?      Sl   15:56   2:16 neutron-api: uWSGI worker 2
42424     224941  1.1  0.4 1277756 281028 ?      Sl   16:05   0:22 octavia-worker: ConsumerService worker(0)
root       42551 16.7  0.4 3388208 278780 ?      Ssl  15:20  13:13 /usr/bin/kubelet --bootstrap-kubeconfig=/etc/kubernetes/bootstrap-kubelet.conf --kubeconfig=/etc/kubernetes/kubelet.conf --config=/var/lib/kubelet/config.yaml --cgroups-per-qos=false --container-runtime-endpoint=unix:///run/containerd/containerd.sock --enforce-node-allocatable= --node-ip=199.204.45.20 --pod-infra-container-image=harbor.atmosphere.dev/registry.k8s.io/pause:3.9
167        25615  0.9  0.3 751068 244424 ?       Sl   15:17   0:48 /usr/bin/ceph-osd -n osd.0 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
10001      69216  1.2  0.3 1638368 236396 ?      Ssl  15:30   0:52 /usr/bin/loki -config.file=/etc/loki/config/config.yaml -target=all
42424     224944  0.9  0.3 1244988 228328 ?      Sl   16:05   0:19 octavia-worker: ConsumerService worker(1)
167        34838  0.9  0.3 745920 224840 ?       Sl   15:18   0:45 /usr/bin/ceph-osd -n osd.2 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
42424     191131  1.8  0.3 1840016 218080 ?      Ssl  15:57   0:46 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-compute --config-file /etc/nova/nova.conf --config-file /tmp/pod-shared/nova-console.conf --config-file /tmp/pod-shared/nova-libvirt.conf --config-file /tmp/pod-shared/nova-compute-fqdn.conf --config-file /tmp/pod-shared/nova-hypervisor.conf
999       172791  2.4  0.3 4320752 213204 ?      Sl   15:53   1:08 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
42424     127625  0.3  0.2 3686664 197224 ?      Sl   15:46   0:11 /var/lib/openstack/bin/python /var/lib/openstack/bin/cinder-volume --config-file /etc/cinder/cinder.conf --config-file /etc/cinder/conf/backends.conf --config-file /tmp/pod-shared/internal_tenant.conf
42424     184046  1.5  0.2 221804 195056 ?       S    15:56   0:40 neutron-server: rpc worker (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-rpc-server --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/taas_plugin.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini)
42424     184045  1.8  0.2 220780 194184 ?       S    15:56   0:49 neutron-server: rpc worker (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-rpc-server --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/taas_plugin.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini)
999       158049  1.5  0.2 4310080 191108 ?      Sl   15:49   0:46 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
root       42323  2.1  0.2 1414320 188356 ?      Ssl  15:20   1:42 kube-controller-manager --authentication-kubeconfig=/etc/kubernetes/controller-manager.conf --authorization-kubeconfig=/etc/kubernetes/controller-manager.conf --bind-address=0.0.0.0 --client-ca-file=/etc/kubernetes/pki/ca.crt --cluster-name=kubernetes --cluster-signing-cert-file=/etc/kubernetes/pki/ca.crt --cluster-signing-key-file=/etc/kubernetes/pki/ca.key --controllers=*,bootstrapsigner,tokencleaner --kubeconfig=/etc/kubernetes/controller-manager.conf --leader-elect=true --requestheader-client-ca-file=/etc/kubernetes/pki/front-proxy-ca.crt --root-ca-file=/etc/kubernetes/pki/ca.crt --service-account-private-key-file=/etc/kubernetes/pki/sa.key --tls-min-version=VersionTLS13 --use-service-account-credentials=true
999       111684  1.0  0.2 4292844 187936 ?      Sl   15:41   0:36 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
42424     170783  0.7  0.2 199788 184512 ?       S    15:52   0:20 nova-api: uWSGI worker 1
42424     123100  0.3  0.2 509108 183592 ?       Sl   15:44   0:13 cinder-api: uWSGI worker 2
42424     123099  0.3  0.2 508152 182632 ?       Sl   15:44   0:12 cinder-api: uWSGI worker 1
472        66464  0.6  0.2 1656376 182328 ?      Ssl  15:30   0:27 grafana server --homepath=/usr/share/grafana --config=/etc/grafana/grafana.ini --packaging=docker cfg:default.log.mode=console cfg:default.paths.data=/var/lib/grafana/ cfg:default.paths.logs=/var/log/grafana cfg:default.paths.plugins=/var/lib/grafana/plugins cfg:default.paths.provisioning=/etc/grafana/provisioning
42424     170784  0.7  0.2 197764 182320 ?       S    15:52   0:20 nova-api: uWSGI worker 2
root       42400  7.1  0.2 11427744 182160 ?     Ssl  15:20   5:39 etcd --advertise-client-urls=https://199.204.45.20:2379 --cert-file=/etc/kubernetes/pki/etcd/server.crt --client-cert-auth=true --data-dir=/var/lib/etcd --experimental-initial-corrupt-check=true --experimental-watch-progress-notify-interval=5s --initial-advertise-peer-urls=https://199.204.45.20:2380 --initial-cluster=instance=https://199.204.45.20:2380 --key-file=/etc/kubernetes/pki/etcd/server.key --listen-client-urls=https://127.0.0.1:2379,https://199.204.45.20:2379 --listen-metrics-urls=http://127.0.0.1:2381 --listen-peer-urls=https://199.204.45.20:2380 --name=instance --peer-cert-file=/etc/kubernetes/pki/etcd/peer.crt --peer-client-cert-auth=true --peer-key-file=/etc/kubernetes/pki/etcd/peer.key --peer-trusted-ca-file=/etc/kubernetes/pki/etcd/ca.crt --snapshot-count=10000 --tls-min-version=TLS1.3 --trusted-ca-file=/etc/kubernetes/pki/etcd/ca.crt
42424     108437  0.7  0.2 1281456 180700 ?      S    15:40   0:27 glance-api: uWSGI worker 1
42424     183595  0.2  0.2 193004 180224 ?       Ss   15:56   0:07 /var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-rpc-server --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/taas_plugin.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini
42424     184649  1.7  0.2 191172 178384 ?       Ss   15:56   0:44 neutron-openvswitch-agent (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-openvswitch-agent --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /tmp/pod-shared/ml2-local-ip.ini --config-file /etc/neutron/plugins/ml2/taas.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini)
999       206697  0.9  0.2 4283728 178356 ?      Sl   16:01   0:22 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
999        70076  0.7  0.2 4280444 177288 ?      Sl   15:30   0:30 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
999       247593  1.0  0.2 4285516 176932 ?      Sl   16:10   0:18 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
root       43966  3.0  0.2 1398904 176228 ?      Ssl  15:21   2:22 cilium-agent --config-dir=/tmp/cilium/config-map
999       187920  1.1  0.2 4289216 176164 ?      Sl   15:57   0:28 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
999        81124  0.7  0.2 4283448 174404 ?      Sl   15:34   0:28 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
999        95432  0.7  0.2 4277912 174188 ?      Sl   15:38   0:28 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
999       226340  0.9  0.2 4278092 174064 ?      Sl   16:05   0:19 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/beam.smp -W w -MBas ageffcbf -MHas ageffcbf -MBlmbcs 512 -MHlmbcs 512 -MMmcs 30 -pc unicode -P 1048576 -t 5000000 -stbt db -zdbbl 128000 -sbwt none -sbwtdcpu none -sbwtdio none -B i -- -root /opt/erlang/lib/erlang -bindir /opt/erlang/lib/erlang/erts-14.2.5.1/bin -progname erl -- -home /var/lib/rabbitmq -- -pa  -noshell -noinput -s rabbit boot -boot start_sasl -syslog logger [] -syslog syslog_error_logger false -kernel prevent_overlapping_partitions false
42424     108438  0.4  0.2 1204612 167824 ?      S    15:40   0:14 glance-api: uWSGI worker 2
42424     184047  0.0  0.2 193068 166384 ?       S    15:56   0:02 neutron-server: rpc reports worker (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-rpc-server --config-file /etc/neutron/neutron.conf --config-file /etc/neutron/taas_plugin.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini)
42424     127411  0.8  0.2 195244 165480 ?       Ss   15:46   0:28 /var/lib/openstack/bin/python /var/lib/openstack/bin/cinder-volume --config-file /etc/cinder/cinder.conf --config-file /etc/cinder/conf/backends.conf --config-file /tmp/pod-shared/internal_tenant.conf
42424     186191  1.6  0.2 178668 165400 ?       Ss   15:56   0:42 neutron-dhcp-agent (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-dhcp-agent --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/dhcp_agent.ini)
42424     186151  0.7  0.2 178768 165248 ?       Ss   15:56   0:18 neutron-l3-agent (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-l3-agent --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/l3_agent.ini)
42424     124562  0.2  0.2 194104 165232 ?       Ss   15:45   0:08 /var/lib/openstack/bin/python /var/lib/openstack/bin/cinder-scheduler --config-file /etc/cinder/cinder.conf
42424     183665  0.2  0.2 180676 164684 ?       S    15:56   0:06 neutron-policy-server: uWSGI worker 1
42424     183666  0.2  0.2 180676 164684 ?       S    15:56   0:06 neutron-policy-server: uWSGI worker 2
42424     186171  0.2  0.2 540932 160248 ?       Ssl  15:56   0:06 neutron-metadata-agent (/var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-metadata-agent --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/metadata_agent.ini)
root      126976  0.2  0.2 5425304 157856 ?      Ssl  15:46   0:06 /var/lib/openstack/bin/python /var/lib/openstack/bin/cinder-backup --config-file /etc/cinder/cinder.conf
root      187159  0.7  0.2 660720 155432 ?       Sl   15:56   0:19 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/dhcp_agent.ini --privsep_context neutron.privileged.default --privsep_sock_path /tmp/tmpmk6idf0o/privsep.sock
root      374506  1.6  0.2 584860 153408 ?       Sl   16:31   0:08 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/l3_agent.ini --privsep_context neutron.privileged.default --privsep_sock_path /tmp/tmpvrppn17d/privsep.sock
42424      75192  2.9  0.2 868540 152880 ?       Sl   15:32   1:59 (wsgi:k -DFOREGROUND
42424      75193  2.8  0.2 868540 152168 ?       Sl   15:32   1:54 (wsgi:k -DFOREGROUND
42424     110126  0.0  0.2 389616 151188 ?       Sl   15:41   0:00 staffeln-conductor: Staffeln conductor backup controller worker(0)
root      374965  1.0  0.2 656464 149980 ?       Sl   16:31   0:05 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/l3_agent.ini --privsep_context neutron.privileged.link_cmd --privsep_sock_path /tmp/tmpooji9g_c/privsep.sock
42424     202838  0.9  0.2 164052 149872 ?       Ss   16:00   0:22 /var/lib/openstack/bin/python /var/lib/openstack/bin/heat-engine --config-file /etc/heat/heat.conf
root      184992  0.1  0.2 435264 149824 ?       Sl   15:56   0:04 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /tmp/pod-shared/ml2-local-ip.ini --config-file /etc/neutron/plugins/ml2/taas.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini --privsep_context neutron.privileged.default --privsep_sock_path /tmp/tmp0om7qy6l/privsep.sock
42424      75194  2.8  0.2 867516 149368 ?       Sl   15:32   1:56 (wsgi:k -DFOREGROUND
42424      75191  2.9  0.2 866492 149328 ?       Sl   15:32   2:00 (wsgi:k -DFOREGROUND
root      188300  0.1  0.2 214024 147960 ?       Sl   15:57   0:04 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/dhcp_agent.ini --privsep_context neutron.privileged.link_cmd --privsep_sock_path /tmp/tmp0546gj5w/privsep.sock
root      186627  0.1  0.2 361492 147848 ?       Sl   15:56   0:03 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/l3_agent.ini --privsep_context neutron.privileged.namespace_cmd --privsep_sock_path /tmp/tmpeq5hekzp/privsep.sock
root      187706  0.1  0.2 214012 147784 ?       Sl   15:57   0:03 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/dhcp_agent.ini --privsep_context neutron.privileged.namespace_cmd --privsep_sock_path /tmp/tmpj7tw5l42/privsep.sock
42424     170862  0.2  0.2 160140 145408 ?       S    15:52   0:05 nova-metadata: uWSGI worker 2
42424     223155  0.4  0.2 306296 143576 ?       Sl   16:05   0:09 octavia-api: uWSGI worker 2
42424     223154  0.4  0.2 305588 143336 ?       Sl   16:05   0:10 octavia-api: uWSGI worker 1
42424     170861  0.2  0.2 158272 143264 ?       S    15:52   0:05 nova-metadata: uWSGI worker 1
root       68062  1.7  0.2 693716 141188 ?       Ssl  15:30   1:11 /usr/bin/vector --config-dir /etc/vector/
root      391464  0.0  0.2 390352 140912 ?       Sl   16:34   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-keepalived-state-change --router_id=51b74489-b4d8-4c1f-98a2-449416085ca3 --namespace=qrouter-51b74489-b4d8-4c1f-98a2-449416085ca3 --conf_dir=/var/lib/neutron/ha_confs/51b74489-b4d8-4c1f-98a2-449416085ca3 --log-file=/var/lib/neutron/ha_confs/51b74489-b4d8-4c1f-98a2-449416085ca3/neutron-keepalived-state-change.log --monitor_interface=ha-9e8d215e-a4 --monitor_cidr=169.254.0.112/24 --pid_file=/var/lib/neutron/external/pids/51b74489-b4d8-4c1f-98a2-449416085ca3.monitor.pid.neutron-keepalived-state-change-monitor --state_path=/var/lib/neutron --user=42424 --group=42424
root      385558  0.0  0.2 390344 140740 ?       Sl   16:33   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-keepalived-state-change --router_id=f79024e7-e1de-4b7a-b331-ccdcf80bcc51 --namespace=qrouter-f79024e7-e1de-4b7a-b331-ccdcf80bcc51 --conf_dir=/var/lib/neutron/ha_confs/f79024e7-e1de-4b7a-b331-ccdcf80bcc51 --log-file=/var/lib/neutron/ha_confs/f79024e7-e1de-4b7a-b331-ccdcf80bcc51/neutron-keepalived-state-change.log --monitor_interface=ha-3c13deb5-49 --monitor_cidr=169.254.0.213/24 --pid_file=/var/lib/neutron/external/pids/f79024e7-e1de-4b7a-b331-ccdcf80bcc51.monitor.pid.neutron-keepalived-state-change-monitor --state_path=/var/lib/neutron --user=42424 --group=42424
42424     166327  0.2  0.2 742552 140456 ?       Ss   15:51   0:06 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-novncproxy --config-file /etc/nova/nova.conf --config-file /tmp/pod-shared/nova-vnc.ini
42424     171959  0.4  0.2 163676 139892 ?       S    15:53   0:13 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-conductor --config-file /etc/nova/nova.conf
42424     171958  0.4  0.2 163572 139000 ?       S    15:53   0:13 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-conductor --config-file /etc/nova/nova.conf
42424     171452  0.9  0.2 150500 138912 ?       Ss   15:53   0:25 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-conductor --config-file /etc/nova/nova.conf
42424     171677  0.9  0.2 150624 138632 ?       Ss   15:53   0:25 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-scheduler --config-file /etc/nova/nova.conf
42424     261029  0.3  0.2 226252 137936 ?       Sl   16:13   0:05 manila-api: uWSGI worker 1
42424     203313  0.0  0.2 167280 137796 ?       S    16:00   0:01 /var/lib/openstack/bin/python /var/lib/openstack/bin/heat-engine --config-file /etc/heat/heat.conf
42424     203314  0.0  0.2 167280 137780 ?       S    16:00   0:01 /var/lib/openstack/bin/python /var/lib/openstack/bin/heat-engine --config-file /etc/heat/heat.conf
42424     261030  0.3  0.2 225208 137468 ?       Sl   16:13   0:05 manila-api: uWSGI worker 2
42424     268006  0.4  0.2 860692 133700 ?       Sl   16:14   0:06 (wsgi:h -DFOREGROUND
42424     268003  0.4  0.2 859668 132536 ?       Sl   16:14   0:06 (wsgi:h -DFOREGROUND
42424     109985  0.0  0.1 217936 131524 ?       Ssl  15:41   0:03 staffeln-conductor: master process [/var/lib/openstack/bin/staffeln-conductor --config-file /etc/staffeln/staffeln.conf]
42424     224444  0.2  0.1 288028 130876 ?       Ssl  16:05   0:05 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-housekeeping --config-file /etc/octavia/octavia.conf
42424     172037  0.1  0.1 152812 128664 ?       S    15:53   0:04 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-scheduler --config-file /etc/nova/nova.conf
42424     172038  0.1  0.1 152812 128620 ?       S    15:53   0:03 /var/lib/openstack/bin/python /var/lib/openstack/bin/nova-scheduler --config-file /etc/nova/nova.conf
42424     224468  0.2  0.1 214016 127656 ?       Ssl  16:05   0:05 octavia-worker: master process [/var/lib/openstack/bin/octavia-worker --config-file /etc/octavia/octavia.conf]
42424     268007  0.3  0.1 633352 127436 ?       Sl   16:14   0:04 (wsgi:h -DFOREGROUND
root      225279  0.2  0.1 139808 127144 ?       Ss   16:05   0:05 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
42424     244345  0.3  0.1 287288 126228 ?       Ssl  16:09   0:06 /var/lib/openstack/bin/python /var/lib/openstack/bin/magnum-cluster-api-proxy
42424     268004  0.2  0.1 632328 125504 ?       Sl   16:14   0:04 (wsgi:h -DFOREGROUND
42424     268005  0.3  0.1 632328 124800 ?       Sl   16:14   0:04 (wsgi:h -DFOREGROUND
42424     261104  0.3  0.1 136036 124544 ?       Ss   16:13   0:05 /var/lib/openstack/bin/python /var/lib/openstack/bin/manila-scheduler --config-file /etc/manila/manila.conf
42424     110130  0.0  0.1 374652 124352 ?       Sl   15:41   0:00 staffeln-conductor: Staffeln conductor rotation controller worker(0)
167        99045  0.3  0.1 5241012 123524 ?      Ssl  15:38   0:13 radosgw --fsid=4837cbf8-4f90-4300-b3f6-726c9b9f89b4 --keyring=/etc/ceph/keyring-store/keyring --default-log-to-stderr=true --default-err-to-stderr=true --default-mon-cluster-log-to-stderr=true --default-log-stderr-prefix=debug  --default-log-to-file=false --default-mon-cluster-log-to-file=false --mon-host=[v2:10.96.240.200:3300,v1:10.96.240.200:6789] --mon-initial-members=instance --id=rgw.ceph.a --setuser=ceph --setgroup=ceph --foreground --rgw-frontends=beast port=8080 --host=rook-ceph-rgw-ceph-a-699b8bdb59-sb5vl --rgw-mime-types-file=/etc/ceph/rgw/mime.types --rgw-realm=ceph --rgw-zonegroup=ceph --rgw-zone=ceph
42424     261438  0.2  0.1 149128 122756 ?       S    16:13   0:03 /var/lib/openstack/bin/python /var/lib/openstack/bin/manila-share --config-file /etc/manila/manila.conf --config-file /tmp/pod-shared/manila-share-fqdn.conf
42424     261124  0.3  0.1 131820 119816 ?       Ss   16:13   0:05 /var/lib/openstack/bin/python /var/lib/openstack/bin/manila-data --config-file /etc/manila/manila.conf
root         372  0.3  0.1 183132 118360 ?       S<s  15:06   0:19 /lib/systemd/systemd-journald
root      225843  0.2  0.1 143056 116820 ?       S    16:05   0:04 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396213  0.0  0.1 141936 115784 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396236  0.0  0.1 289432 115696 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396234  0.0  0.1 289432 115676 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396237  0.0  0.1 289432 115676 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396238  0.0  0.1 289432 115676 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396232  0.0  0.1 289432 115664 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396233  0.0  0.1 289432 115664 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396235  0.0  0.1 289432 115664 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396231  0.0  0.1 289432 115660 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396217  0.0  0.1 141936 115592 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396218  0.0  0.1 141936 115592 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396220  0.0  0.1 141936 115592 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396221  0.0  0.1 141936 115592 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396216  0.0  0.1 141936 115588 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396219  0.0  0.1 141936 115584 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396210  0.0  0.1 141936 115580 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396215  0.0  0.1 141936 115580 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396214  0.0  0.1 141936 115576 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396211  0.0  0.1 141936 115568 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396212  0.0  0.1 141936 115568 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
42424      87772  0.1  0.1 129632 114704 ?       S    15:36   0:04 barbiacan-api: uWSGI worker 1
65532      44879  0.2  0.1 1415060 113900 ?      Ssl  15:21   0:09 /usr/local/bin/envoy-gateway server --config-path=/config/envoy-gateway.yaml
root      396228  0.0  0.1 287384 113896 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396239  0.0  0.1 287384 113772 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396229  0.0  0.1 287384 113764 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396230  0.0  0.1 287384 113764 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      225842  0.0  0.1 434840 113464 ?       Sl   16:05   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
42424     261216  0.9  0.1 125396 111896 ?       Ss   16:13   0:15 /var/lib/openstack/bin/python /var/lib/openstack/bin/manila-share --config-file /etc/manila/manila.conf --config-file /tmp/pod-shared/manila-share-fqdn.conf
root      396240  0.0  0.1 287344 110004 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396241  0.0  0.1 287344 110004 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396242  0.0  0.1 287344 110004 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396243  0.0  0.1 287344 110004 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396222  0.0  0.1 139848 109884 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396223  0.0  0.1 139848 109884 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396224  0.0  0.1 139848 109884 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
root      396225  0.0  0.1 139848 109884 ?       S    16:35   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/octavia-health-manager --config-file /etc/octavia/octavia.conf
167        12623  1.0  0.1 327388 109500 ?       Sl   15:13   0:55 /usr/bin/ceph-mon -n mon.instance -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug  --default-mon-cluster-log-to-file=false --default-mon-cluster-log-to-stderr=true
42424     244750  1.0  0.1 120864 109228 ?       Ss   16:09   0:19 /var/lib/openstack/bin/python /var/lib/openstack/bin/magnum-conductor --config-file /etc/magnum/magnum.conf --config-file /tmp/pod-shared/magnum.conf
42424     244636  0.2  0.1 121760 106552 ?       S    16:09   0:04 magnum-api: uWSGI worker 1
42424     244637  0.2  0.1 121760 106552 ?       S    16:09   0:05 magnum-api: uWSGI worker 2
42424     202643  0.1  0.1 119844 102488 ?       S    16:00   0:03 heat-api: uWSGI worker 1
42424     202644  0.1  0.1 119844 102488 ?       S    16:00   0:03 heat-api: uWSGI worker 2
42424     202645  0.1  0.1 119804 101824 ?       S    16:00   0:04 heat-api-cfn: uWSGI worker 1
42424     202646  0.1  0.1 119804 101824 ?       S    16:00   0:03 heat-api-cfn: uWSGI worker 2
zuul       46454  0.1  0.1 1337732 98932 ?       Ssl  15:21   0:09 /app/cmd/cainjector/cainjector --v=2 --leader-election-namespace=cert-manager
root      134345  0.2  0.1 110512 95516 ?        S    15:48   0:08 placement-api: uWSGI worker 1
root      134346  0.2  0.1 109536 95412 ?        S    15:48   0:07 placement-api: uWSGI worker 2
42424     245052  0.0  0.1 118552 92904 ?        S    16:09   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/magnum-conductor --config-file /etc/magnum/magnum.conf --config-file /tmp/pod-shared/magnum.conf
42424     245053  0.0  0.1 118552 92904 ?        S    16:09   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/magnum-conductor --config-file /etc/magnum/magnum.conf --config-file /tmp/pod-shared/magnum.conf
2016       89412  0.1  0.1 5492616 90904 ?       Ssl  15:36   0:07 /usr/local/bin/rook ceph operator
42424     111203  0.1  0.1 166548 90700 ?        Ss   15:41   0:04 /var/lib/openstack/bin/python /var/lib/openstack/bin/staffeln-api --config-file /etc/staffeln/staffeln.conf
bin        50020  1.2  0.1 1284620 87592 ?       Ssl  15:22   0:58 percona-xtradb-cluster-operator
zuul       46543  0.3  0.1 1292260 80440 ?       Ssl  15:22   0:17 /app/cmd/controller/controller --v=2 --cluster-resource-namespace=cert-manager --leader-election-namespace=cert-manager --acme-http01-solver-image=harbor.atmosphere.dev/quay.io/jetstack/cert-manager-acmesolver:v1.12.17 --feature-gates=AdditionalCertificateOutputFormats=true --max-concurrent-challenges=60
root      375980  0.2  0.1 244180 80244 ?        Sl   16:31   0:01 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/nova/nova.conf --config-file /tmp/pod-shared/nova-console.conf --config-file /tmp/pod-shared/nova-libvirt.conf --config-file /tmp/pod-shared/nova-compute-fqdn.conf --config-file /tmp/pod-shared/nova-hypervisor.conf --privsep_context vif_plug_ovs.privsep.vif_plug --privsep_sock_path /tmp/tmp_pw67qtv/privsep.sock
root      378201  0.1  0.1 169496 79744 ?        Sl   16:31   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/dhcp_agent.ini --privsep_context neutron.privileged.dhcp_release_cmd --privsep_sock_path /tmp/tmpt9mdjvkq/privsep.sock
root       43755  0.3  0.1 1306536 78872 ?       Ssl  15:21   0:14 cilium-operator-generic --config-dir=/tmp/cilium/config-map --debug=false
root      375661  0.0  0.1 241544 76532 ?        Sl   16:31   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/nova/nova.conf --config-file /tmp/pod-shared/nova-console.conf --config-file /tmp/pod-shared/nova-libvirt.conf --config-file /tmp/pod-shared/nova-compute-fqdn.conf --config-file /tmp/pod-shared/nova-hypervisor.conf --privsep_context nova.privsep.sys_admin_pctxt --privsep_sock_path /tmp/tmpm167xmcc/privsep.sock
root       10332  2.3  0.1 2467604 75996 ?       Ssl  15:12   2:04 /usr/bin/dockerd -H fd:// --containerd=/run/containerd/containerd.sock
root      185163  0.0  0.1 167608 74272 ?        Sl   15:56   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/neutron/neutron.conf --config-file /tmp/pod-shared/neutron-agent.ini --config-file /tmp/pod-shared/ml2-local-ip.ini --config-file /etc/neutron/plugins/ml2/taas.ini --config-file /etc/neutron/plugins/ml2/openvswitch_agent.ini --config-file /etc/neutron/plugins/ml2/ml2_conf.ini --privsep_context neutron.privileged.ovs_vsctl_cmd --privsep_sock_path /tmp/tmp1zscik6_/privsep.sock
root      245025  0.0  0.1 1296452 73696 ?       Sl   16:09   0:00 haproxy -f /var/lib/magnum/.magnum-cluster-api-proxy/haproxy.cfg
root       68113  0.2  0.1 147020 72180 ?        S    15:30   0:10 journalctl --follow --all --show-cursor --output=json --boot --since=2000-01-01
systemd+   48741  0.3  0.1 1283008 72120 ?       Ssl  15:22   0:17 /nginx-ingress-controller --default-backend-service=ingress-nginx/ingress-nginx-defaultbackend --publish-service=ingress-nginx/ingress-nginx-controller --election-id=ingress-nginx-leader --controller-class=k8s.io/ingress-nginx --ingress-class=atmosphere --configmap=ingress-nginx/ingress-nginx-controller --tcp-services-configmap=ingress-nginx/ingress-nginx-tcp --udp-services-configmap=ingress-nginx/ingress-nginx-udp --validating-webhook=:7443 --validating-webhook-certificate=/usr/local/certificates/cert --validating-webhook-key=/usr/local/certificates/key --enable-metrics=true
root       42374  0.4  0.1 1286164 72084 ?       Ssl  15:20   0:21 kube-scheduler --authentication-kubeconfig=/etc/kubernetes/scheduler.conf --authorization-kubeconfig=/etc/kubernetes/scheduler.conf --bind-address=0.0.0.0 --kubeconfig=/etc/kubernetes/scheduler.conf --leader-elect=true --tls-min-version=VersionTLS13
nobody     64524  3.0  0.1 1287832 70624 ?       Ssl  15:29   2:08 /bin/operator --kubelet-service=kube-system/kube-prometheus-stack-kubelet --localhost=127.0.0.1 --prometheus-config-reloader=harbor.atmosphere.dev/quay.io/prometheus-operator/prometheus-config-reloader:v0.73.0 --config-reloader-cpu-request=0 --config-reloader-cpu-limit=0 --config-reloader-memory-request=0 --config-reloader-memory-limit=0 --thanos-default-base-image=quay.io/thanos/thanos:v0.35.1 --secret-field-selector=type!=kubernetes.io/dockercfg,type!=kubernetes.io/service-account-token,type!=helm.sh/release.v1 --web.enable-tls=true --web.cert-file=/cert/cert --web.key-file=/cert/key --web.listen-address=:10250 --web.tls-min-version=VersionTLS13
root      376063  0.0  0.1 241176 70404 ?        Sl   16:31   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --config-file /etc/nova/nova.conf --privsep_context os_brick.privileged.default --privsep_sock_path /tmp/tmpalqph2r7/privsep.sock
root      245019  0.0  0.1 167460 69832 ?        Sl   16:09   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/privsep-helper --privsep_context magnum_cluster_api.privsep.haproxy_pctxt --privsep_sock_path /tmp/tmp0hidr3mk/privsep.sock
65532     231874  0.4  0.1 1292136 67504 ?       Ssl  16:06   0:08 /manager --leader-elect --diagnostics-address=:8443 --insecure-diagnostics=false --feature-gates=MachinePool=true,ClusterTopology=true,RuntimeSDK=false,MachineSetPreflightChecks=true,MachineWaitForVolumeDetachConsiderVolumeAttachments=true,PriorityQueue=true,ReconcilerRateLimiting=true,InPlaceUpdates=false,MachineTaintPropagation=false
65532     228653  0.4  0.0 1285908 64800 ?       Ssl  16:06   0:09 /manager --metrics-bind-address=:8443 --leader-elect --health-probe-bind-address=:8081
472        64995  0.0  0.0  70024 64080 ?        Ss   15:29   0:02 python -u /app/sidecar.py
472        64969  0.0  0.0  70024 64056 ?        Ss   15:29   0:02 python -u /app/sidecar.py
472        65287  0.1  0.0  72712 63760 ?        S    15:29   0:07 python -u /app/sidecar.py
65532     230699  0.2  0.0 1292452 62880 ?       Ssl  16:06   0:05 /manager --leader-elect --diagnostics-address=:8443 --insecure-diagnostics=false --feature-gates=MachinePool=true,ClusterTopology=true,KubeadmBootstrapFormatIgnition=false,PriorityQueue=true,ReconcilerRateLimiting=true,InPlaceUpdates=false,MachineTaintPropagation=false
65532     233419  0.3  0.0 1291828 61564 ?       Ssl  16:07   0:05 /manager --leader-elect --v=2 --diagnostics-address=127.0.0.1:8080 --insecure-diagnostics=true --feature-gates=PriorityQueue=false,AutoScaleFromZero=false
472        65289  0.0  0.0  70472 61356 ?        S    15:29   0:00 python -u /app/sidecar.py
472        65286  0.0  0.0  70472 61160 ?        S    15:29   0:00 python -u /app/sidecar.py
472        65288  0.0  0.0  70472 60992 ?        S    15:29   0:00 python -u /app/sidecar.py
65532     229835  0.2  0.0 1286724 58148 ?       Ssl  16:06   0:05 /manager --leader-elect --diagnostics-address=:8443 --insecure-diagnostics=false --feature-gates=MachinePool=true,KubeadmBootstrapFormatIgnition=false,PriorityQueue=true,ReconcilerRateLimiting=true --bootstrap-token-ttl=15m
65532     157209  0.2  0.0 770384 55764 ?        Ssl  15:49   0:06 /coredns -conf /etc/coredns/Corefile
root       45354  0.6  0.0 767728 55648 ?        Ssl  15:21   0:31 /coredns -conf /etc/coredns/Corefile
nobody     58981  0.1  0.0 1281608 55404 ?       Ssl  15:27   0:05 nfd-master -crd-controller=true -metrics=8081
root       45374  0.5  0.0 767472 55204 ?        Ssl  15:21   0:26 /coredns -conf /etc/coredns/Corefile
root       42701  0.0  0.0 1283972 55140 ?       Ssl  15:20   0:03 /usr/local/bin/kube-proxy --config=/var/lib/kube-proxy/config.conf --hostname-override=instance
nobody     64313  0.3  0.0 1271524 49800 ?       Ssl  15:29   0:14 /kube-state-metrics --port=8080 --telemetry-port=8081 --port=8080 --resources=certificatesigningrequests,configmaps,cronjobs,daemonsets,deployments,endpoints,horizontalpodautoscalers,ingresses,jobs,leases,limitranges,mutatingwebhookconfigurations,namespaces,networkpolicies,nodes,persistentvolumeclaims,persistentvolumes,poddisruptionbudgets,pods,replicasets,replicationcontrollers,resourcequotas,secrets,services,statefulsets,storageclasses,validatingwebhookconfigurations,volumeattachments
ubuntu     49575  0.2  0.0 1272088 48068 ?       Ssl  15:22   0:10 /manager --metrics-bind-address=:9782
root      188675  0.0  0.0 426744 46592 ?        Sl   15:57   0:01 /var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-rootwrap-daemon /etc/neutron/rootwrap.conf
zuul       46499  0.1  0.0 1281856 46160 ?       Ssl  15:22   0:04 /app/cmd/webhook/webhook --v=2 --secure-port=10250 --feature-gates=AdditionalCertificateOutputFormats=true --dynamic-serving-ca-secret-namespace=cert-manager --dynamic-serving-ca-secret-name=cert-manager-webhook-ca --dynamic-serving-dns-names=cert-manager-webhook --dynamic-serving-dns-names=cert-manager-webhook.cert-manager --dynamic-serving-dns-names=cert-manager-webhook.cert-manager.svc --feature-gates=AdditionalCertificateOutputFormats=true
root      375324  0.1  0.0 500492 46128 ?        Sl   16:31   0:00 /var/lib/openstack/bin/python /var/lib/openstack/bin/neutron-rootwrap-daemon /etc/neutron/rootwrap.conf
root      187598  0.0  0.0 2146068 44976 ?       Ssl  15:57   0:00 /usr/bin/libvirt-tls-sidecar
zuul       59139  0.1  0.0 1267068 44320 ?       Ssl  15:27   0:05 /secretgen-controller
zuul       68852  0.0  0.0 1270924 44196 ?       Ssl  15:30   0:00 /bin/prometheus-config-reloader --listen-address=:8080 --reload-url=http://127.0.0.1:9090/-/reload --config-file=/etc/prometheus/config/prometheus.yaml.gz --config-envsubst-file=/etc/prometheus/config_out/prometheus.env.yaml --watched-dir=/etc/prometheus/rules/prometheus-kube-prometheus-stack-prometheus-rulefiles-0
zuul       68551  0.0  0.0 1270924 41808 ?       Ssl  15:30   0:00 /bin/prometheus-config-reloader --listen-address=:8080 --reload-url=http://127.0.0.1:9093/-/reload --config-file=/etc/alertmanager/config/alertmanager.yaml.gz --config-envsubst-file=/etc/alertmanager/config_out/alertmanager.env.yaml --watched-dir=/etc/alertmanager/config
ubuntu     49686  0.2  0.0 1269340 40784 ?       Ssl  15:22   0:11 /manager --metrics-bind-address=:8080
root       42489  0.3  0.0 1273436 39904 ?       Ssl  15:20   0:18 /kube-vip manager
zuul       68511  0.0  0.0 1257960 39112 ?       Ssl  15:30   0:02 /bin/alertmanager --config.file=/etc/alertmanager/config_out/alertmanager.env.yaml --storage.path=/alertmanager --data.retention=120h --cluster.listen-address= --web.listen-address=:9093 --web.external-url=http://alertmanager.199-204-45-20.nip.io/ --web.route-prefix=/ --cluster.label=monitoring/kube-prometheus-stack-alertmanager --cluster.peer=alertmanager-kube-prometheus-stack-alertmanager-0.alertmanager-operated:9094 --cluster.reconnect-timeout=5m --web.config.file=/etc/alertmanager/web_config/web-config.yaml
nobody     58897  0.2  0.0 2592740 38688 ?       Ssl  15:27   0:11 nfd-worker -metrics=8081
zuul       68414  0.0  0.0 1268324 38256 ?       Ssl  15:30   0:02 /goldpinger --static-file-path /static
root      188304  0.6  0.0 1919784 35988 ?       Sl   15:57   0:17 /usr/sbin/libvirtd --listen
nobody     58934  0.0  0.0 1267048 31492 ?       Ssl  15:27   0:00 nfd-gc -gc-interval=1h
nobody     68454  0.2  0.0 438084 31344 ?        Ssl  15:30   0:09 memcached -v -p 11211 -U 0 -c 8192 -m 1024
zuul       68898  0.0  0.0 1262724 28864 ?       Ssl  15:30   0:00 /usr/bin/pod-tls-sidecar --template=/config/certificate-template.yml --ca-path=/certs/ca.crt --cert-path=/certs/tls.crt --key-path=/certs/tls.key
root       45959  0.0  0.0 735444 28588 ?        Ssl  15:21   0:03 local-path-provisioner --debug start --config /etc/config/config.json --service-account-name local-path-provisioner --provisioner-name cluster.local/local-path-provisioner --helper-image harbor.atmosphere.dev/ghcr.io/containerd/busybox:1.36 --configmap-name local-path-config
nobody     65302  0.0  0.0 1262724 27712 ?       Ssl  15:29   0:00 /usr/bin/pod-tls-sidecar --template=/config/certificate-template.yml --ca-path=/certs/ca.crt --cert-path=/certs/tls.crt --key-path=/certs/tls.key
root       39602  1.8  0.0 503896 26880 ?        Sl   15:19   1:28 /usr/bin/ceph-exporter -n client.ceph-exporter.instance -f --sock-dir=/var/run/ceph/ --addrs=0.0.0.0 --port=9926 --prio-limit=5 --stats-period=5
root      151028  0.0  0.0 223328 26628 ?        SLsl 15:48   0:00 /sbin/multipathd -d -s
42424     155386  0.0  0.0  49708 26476 ?        Ss   15:49   0:02 /usr/sbin/ovsdb-server /run/openvswitch/conf.db -vconsole:emer -vconsole:err -vconsole:info --pidfile=/run/openvswitch/ovsdb-server.pid --remote=punix:/run/openvswitch/db.sock --remote=db:Open_vSwitch,Open_vSwitch,manager_options --private-key=db:Open_vSwitch,SSL,private_key --certificate=db:Open_vSwitch,SSL,certificate --bootstrap-ca-cert=db:Open_vSwitch,SSL,ca_cert
11211      67532  0.0  0.0 433232 26068 ?        Ssl  15:30   0:01 memcached -m 8192 --extended=modern,track_sizes -I 5m -c 16384 -v -u 11211
nobody     67214  1.0  0.0 1241700 24392 ?       Ssl  15:30   0:41 /bin/node_exporter --path.procfs=/host/proc --path.sysfs=/host/sys --path.rootfs=/host/root --path.udev.data=/host/root/run/udev/data --web.listen-address=[0.0.0.0]:9100 --collector.diskstats.ignored-devices=^(ram|loop|nbd|fd|(h|s|v|xv)d[a-z]|nvme\\d+n\\d+p)\\d+$ --collector.filesystem.fs-types-exclude=^(autofs|binfmt_misc|bpf|cgroup2?|configfs|debugfs|devpts|devtmpfs|fusectl|fuse.squashfuse_ll|hugetlbfs|iso9660|mqueue|nsfs|overlay|proc|procfs|pstore|rpc_pipefs|securityfs|selinuxfs|squashfs|sysfs|tracefs)$ --collector.filesystem.mount-points-exclude=^/(dev|proc|run/credentials/.+|sys|var/lib/docker/.+|var/lib/kubelet/pods/.+|var/lib/kubelet/plugins/kubernetes.io/csi/.+|run/containerd/.+)($|/) --collector.ethtool --collector.netclass.ignored-devices=^(lxc|cilium_(host|net)|qbr|qvb|qvo|tap|ovs-system|br|tbr|gre_sys|[0-9a-f]+_eth|vxlan).*$ --collector.netdev.device-exclude=^(lxc|cilium_(host|net)|qbr|qvb|qvo|tap|ovs-system|br|tbr|gre_sys|[0-9a-f]+_eth|vxlan).*$ --collector.processes --collector.systemd --collector.stat.softirq --web.config.file=/config/node-exporter.yml
root      408843  0.0  0.0 106492 22908 ?        Sl   16:39   0:00 /usr/bin/python3
nobody     69283  0.0  0.0 1241444 22756 ?       Ssl  15:30   0:01 /bin/pushgateway
systemd+  265314  0.0  0.0 133208 21932 ?        Sl   16:14   0:00 nginx: worker process
systemd+  265313  0.0  0.0 132952 21764 ?        Sl   16:14   0:00 nginx: worker process
root       25561  0.0  0.0 736072 21676 ?        Sl   15:17   0:00 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-osd --privileged --group-add=disk --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-osd-0 --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.0:/var/lib/ceph/osd/ceph-0:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.0/config:/etc/ceph/ceph.conf:z -v /dev:/dev -v /run/udev:/run/udev -v /sys:/sys -v /run/lvm:/run/lvm -v /run/lock/lvm:/run/lock/lvm -v /:/rootfs quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -n osd.0 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       34782  0.0  0.0 735892 21504 ?        Sl   15:18   0:00 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-osd --privileged --group-add=disk --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-osd-2 --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.2:/var/lib/ceph/osd/ceph-2:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.2/config:/etc/ceph/ceph.conf:z -v /dev:/dev -v /run/udev:/run/udev -v /sys:/sys -v /run/lvm:/run/lvm -v /run/lock/lvm:/run/lock/lvm -v /:/rootfs quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -n osd.2 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       18970  0.0  0.0 735892 21392 ?        Sl   15:14   0:00 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-crash --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-crash-instance --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash.instance/config:/etc/ceph/ceph.conf:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash.instance/keyring:/etc/ceph/ceph.client.crash.instance.keyring quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -n client.crash.instance
root       12523  0.0  0.0 736008 21380 ?        Sl   15:13   0:01 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-mon --privileged --group-add=disk --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-mon-instance --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph:v18 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/mon.instance:/var/lib/ceph/mon/ceph-instance:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/mon.instance/config:/etc/ceph/ceph.conf:z -v /dev:/dev -v /run/udev:/run/udev quay.io/ceph/ceph:v18 -n mon.instance -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug  --default-mon-cluster-log-to-file=false --default-mon-cluster-log-to-stderr=true
root       12888  0.0  0.0 735892 21348 ?        Sl   15:13   0:00 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-mgr --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-mgr-instance-osyhqi --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph:v18 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/mgr.instance.osyhqi:/var/lib/ceph/mgr/ceph-instance.osyhqi:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/mgr.instance.osyhqi/config:/etc/ceph/ceph.conf:z quay.io/ceph/ceph:v18 -n mgr.instance.osyhqi -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       39523  0.0  0.0 735636 21296 ?        Sl   15:19   0:00 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-exporter --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-ceph-exporter-instance --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/ceph-exporter.instance:/var/lib/ceph/ceph-exporter/ceph-instance:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/ceph-exporter.instance/config:/etc/ceph/ceph.conf:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/ceph-exporter.instance/keyring:/etc/ceph/ceph.client.ceph-exporter.instance.keyring quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -n client.ceph-exporter.instance -f --sock-dir=/var/run/ceph/ --addrs=0.0.0.0 --port=9926 --prio-limit=5 --stats-period=5
root       30238  0.0  0.0 736008 20928 ?        Sl   15:17   0:00 /usr/bin/docker run --rm --ipc=host --stop-signal=SIGTERM --ulimit nofile=1048576 --net=host --entrypoint /usr/bin/ceph-osd --privileged --group-add=disk --init --name ceph-4837cbf8-4f90-4300-b3f6-726c9b9f89b4-osd-1 --pids-limit=0 -e CONTAINER_IMAGE=quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -e NODE_NAME=instance -e TCMALLOC_MAX_TOTAL_THREAD_CACHE_BYTES=134217728 -v /var/run/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/run/ceph:z -v /var/log/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4:/var/log/ceph:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash:/var/lib/ceph/crash:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.1:/var/lib/ceph/osd/ceph-1:z -v /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.1/config:/etc/ceph/ceph.conf:z -v /dev:/dev -v /run/udev:/run/udev -v /sys:/sys -v /run/lvm:/run/lvm -v /run/lock/lvm:/run/lock/lvm -v /:/rootfs quay.io/ceph/ceph@sha256:69cbef90eb58cf96e572e7497227a2bcb0ec9175bc2247809c0a37857db9b820 -n osd.1 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root      250931  0.0  0.0 1249380 20812 ?       Ssl  16:11   0:00 docker-registry serve /etc/docker-registry/config.yml
zuul       69555  0.0  0.0 1249504 20384 ?       Ssl  15:30   0:01 /bin/oauth2-proxy
65532     266122  0.0  0.0 1751044 19788 ?       Ssl  16:14   0:01 /bin/openstack-exporter --endpoint-type internal default --collect-metric-time -d cinder-agent_state -d cinder-limits_backup_max_gb -d cinder-limits_backup_used_gb -d cinder-limits_volume_max_gb -d cinder-limits_volume_used_gb -d cinder-snapshots -d cinder-volume_gb -d cinder-volume_status -d cinder-volume_status_counter -d cinder-volume_type_quota_gigabytes -d cinder-volumes --disable-service.identity --disable-service.image --disable-service.placement --disable-service.compute --disable-service.object-store --disable-service.load-balancer --disable-service.container-infra --disable-service.dns --disable-service.baremetal --disable-service.gnocchi --disable-service.database --disable-service.orchestration --disable-service.network
zuul       69531  0.0  0.0 1249248 19760 ?       Ssl  15:30   0:01 /bin/oauth2-proxy
root        1426  0.0  0.0 296164 19600 ?        Ssl  15:10   0:01 /usr/libexec/packagekitd
root      188488  0.0  0.0 1239684 19372 ?       Ssl  15:57   0:00 /prometheus-libvirt-exporter --libvirt.uri /run/libvirt/libvirt-sock-ro
root           1  1.7  0.0 174380 19144 ?        Ss   15:06   1:36 /lib/systemd/systemd --system --deserialize 43 nofb
root      267392  0.0  0.0 1275216 18284 ?       Ssl  16:14   0:01 /bin/openstack-database-exporter
root         624  0.0  0.0  33600 17736 ?        Ss   15:06   0:01 /usr/bin/python3 /usr/bin/networkd-dispatcher --run-startup-triggers
nobody     50913  0.2  0.0 1239532 17400 ?       Ssl  15:23   0:09 /bin/mysqld_exporter --mysqld.username=monitor --collect.info_schema.processlist
zuul         873  0.0  0.0 179616 16452 ?        Sl   15:10   0:01 /usr/bin/python3
42424     404732  0.1  0.0 2602940 16144 ?       Sl   16:38   0:00 apache2 -DFOREGROUND
42424     405646  0.2  0.0 2602948 16144 ?       Sl   16:38   0:00 apache2 -DFOREGROUND
root      134315  0.0  0.0  25264 15840 ?        Ss   15:48   0:00 placement-api: uWSGI master
zuul         713  1.4  0.0  23520 15832 ?        Ss   15:10   1:18 /lib/systemd/systemd --user
42424     183578  0.0  0.0  25376 15828 ?        Ss   15:56   0:00 neutron-api: uWSGI master
42424      87759  0.0  0.0  25100 15804 ?        Ss   15:36   0:00 barbiacan-api: uWSGI master
42424     260929  0.0  0.0  25364 15788 ?        Ss   16:13   0:00 manila-api: uWSGI master
42424     223141  0.0  0.0  25396 15724 ?        Ss   16:05   0:00 octavia-api: uWSGI master
42424     183647  0.0  0.0  25372 15708 ?        Ss   15:56   0:00 neutron-policy-server: uWSGI master
42424     244586  0.0  0.0  25396 15700 ?        Ss   16:09   0:00 magnum-api: uWSGI master
42424     170750  0.0  0.0  25336 15688 ?        Ss   15:52   0:00 nova-api: uWSGI master
42424     108423  0.0  0.0  25328 15664 ?        Ss   15:40   0:00 glance-api: uWSGI master
ubuntu     53459  0.0  0.0 2566024 15632 ?       Ssl  15:24   0:04 redis_exporter
42424     202592  0.0  0.0  25380 15624 ?        Ss   16:00   0:00 heat-api: uWSGI master
42424     202616  0.0  0.0  25380 15612 ?        Ss   16:00   0:00 heat-api-cfn: uWSGI master
cephadm    22010  1.5  0.0  23524 15584 ?        Ss   15:16   1:19 /lib/systemd/systemd --user
42424     123085  0.0  0.0  25348 15580 ?        Ss   15:44   0:00 cinder-api: uWSGI master
42424     170849  0.0  0.0  25336 15420 ?        Ss   15:52   0:00 nova-metadata: uWSGI master
nobody     69491  0.0  0.0 1237148 15400 ?       Ssl  15:30   0:02 /bin/memcached_exporter
167        99840  0.0  0.0  17968 15380 ?        Ss   15:38   0:00 /usr/bin/python3 -s /usr/bin/ceph-crash
systemd+   48880  0.0  0.0 120056 14740 ?        S    15:22   0:00 nginx: master process /usr/bin/nginx -c /etc/nginx/nginx.conf
ubuntu     51865  1.4  0.0 1134480 14640 ?       Sl   15:24   1:03 haproxy -sf 15 -x sockpair@4 -W -db -f /etc/haproxy-custom/haproxy-global.cfg -f /etc/haproxy/pxc/haproxy.cfg -p /etc/haproxy/pxc/haproxy.pid -S /etc/haproxy/pxc/haproxy-main.sock
root      225301  0.0  0.0  14960 14104 ?        Ss   16:05   0:00 dhclient -v o-hm0 -cf /tmp/dhclient.conf
systemd+     406  0.3  0.0  25820 13844 ?        Ss   15:06   0:17 /lib/systemd/systemd-resolved
www-data  268008  0.0  0.0 2011892 13384 ?       Sl   16:14   0:00 apache2 -DFOREGROUND
www-data  268009  0.0  0.0 2011940 13384 ?       Sl   16:14   0:00 apache2 -DFOREGROUND
ubuntu     53068  0.5  0.0 135100 13228 ?        Ssl  15:24   0:26 valkey-server *:6379
root       65515  0.7  0.0 1333876 13184 ?       Sl   15:30   0:31 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 5eccf17cde5375dfe816864486865c1711c49366c5aa33d8ec4b4e24136dbb7c -address /run/containerd/containerd.sock
root      145650  0.0  0.0  13436 13012 ?        S<Ls 15:48   0:00 /sbin/iscsid
root       52808  1.1  0.0 1268524 12816 ?       Sl   15:24   0:51 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 50673f70b53bcce05c33af26319eec5e42d549df6b1b64ffbae553e70b40ee67 -address /run/containerd/containerd.sock
root       50580  0.4  0.0 1268268 12680 ?       Sl   15:23   0:22 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 40fff27210efa85585fcd2450515c492d9e9235b1a706d3ccf62114ff1202406 -address /run/containerd/containerd.sock
root      160073  0.3  0.0 1269036 12676 ?       Sl   15:50   0:11 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id bd0bd79d05cddc29ca621dd89c4c0c388348ba86a92a3bb264ec192558c2b656 -address /run/containerd/containerd.sock
ubuntu     53393  0.5  0.0  56804 12668 ?        Ssl  15:24   0:26 valkey-server *:26379 [sentinel]
root      251703  0.1  0.0 1268780 12660 ?       Sl   16:11   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 1e6b298b7b10dac96b5cefe5cfa57223e9b4c115b797dae5fe925436fcb5dbb4 -address /run/containerd/containerd.sock
root       50166  0.6  0.0 1268524 12532 ?       Sl   15:22   0:28 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id a73f96adba404f21a8a3f6e48b1cbcf481c5d7ec86e3d5f2cb796f1d8b3a37df -address /run/containerd/containerd.sock
root      245022  0.0  0.0  96888 12512 ?        S    16:09   0:00 haproxy -f /var/lib/magnum/.magnum-cluster-api-proxy/haproxy.cfg
root      155030  0.5  0.0 1268524 12508 ?       Sl   15:49   0:17 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id eca4a5faea127d0b14c7b2284056426c1ff5797cfca43b3641842c3cc101443a -address /run/containerd/containerd.sock
ubuntu     50632  0.0  0.0  97388 12500 ?        Ss   15:23   0:00 haproxy -W -db -f /etc/haproxy-custom/haproxy-global.cfg -f /etc/haproxy/pxc/haproxy.cfg -p /etc/haproxy/pxc/haproxy.pid -S /etc/haproxy/pxc/haproxy-main.sock
167        19037  0.0  0.0  14664 12492 ?        S    15:14   0:00 /usr/bin/python3 -s /usr/bin/ceph-crash -n client.crash.instance
root       64052  0.5  0.0 1268268 12412 ?       Sl   15:29   0:22 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id e160caf23b7c09f143ac3c1fecfb9fce22877b4c1fb9e084c0fb2fe6b4858bea -address /run/containerd/containerd.sock
root      160282  0.2  0.0 1268524 12364 ?       Sl   15:50   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id daf746b4339a3f8f781056a0f4861425bb4dfaee302e073a414d1287135209a8 -address /run/containerd/containerd.sock
root      251666  0.1  0.0 1268524 12364 ?       Sl   16:11   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id fb48c67114134af1242c3ec8cca83c955283b030b12008c8e67ed81a52a9a04d -address /run/containerd/containerd.sock
root      226195  0.1  0.0 1333876 12356 ?       Sl   16:05   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 6c6e93a34bd44584fa431dd638d5d1223c43de63713f92695267c90f9c36bdbb -address /run/containerd/containerd.sock
root       68253  0.3  0.0 1268524 12348 ?       Sl   15:30   0:15 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ab1e5017b8e96d78aac24a14f9bab4fdd02e61ad9fef27b2cf9fd3ea792662e3 -address /run/containerd/containerd.sock
root      109602  0.1  0.0 1334132 12340 ?       Sl   15:41   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id fe55c294aead116f9fa3b74e09b0bcbd149359ea07d658b205fe8e3967ab52de -address /run/containerd/containerd.sock
root       65439  0.5  0.0 1268268 12284 ?       Sl   15:30   0:23 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id f598c59c879cf3c259e2619063298ea780ad4dda0535b5448a1c1e6938c64d1e -address /run/containerd/containerd.sock
root      190463  0.1  0.0 1268524 12280 ?       Sl   15:57   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id fb125a1dd5761627675b8832d68db9eb9aa7edcfd462d90af56823de427d0b25 -address /run/containerd/containerd.sock
root      156485  0.5  0.0 1268524 12252 ?       Sl   15:49   0:16 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 11bd30324e6bdc586b4a9fbbaab3c424d699c1e03b89c47c0ee241bbb2643e73 -address /run/containerd/containerd.sock
root      160212  0.2  0.0 1268780 12244 ?       Sl   15:50   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 251ab5f90e21c52f9dfc79b5d4285c46a65f84425a55d69ef1e4f9493be3896d -address /run/containerd/containerd.sock
root       98640  0.1  0.0 1268268 12240 ?       Sl   15:38   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 7bf483fa3104984fd6bd3d92feee3df972d36d484dfc79181e3368a6b021699d -address /run/containerd/containerd.sock
root       69716  0.1  0.0 1268524 12236 ?       Sl   15:30   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id d3e383569ec484ae5e21430701c8390eb56f45464025d8af4d41ad9bdd48a982 -address /run/containerd/containerd.sock
root      214217  0.1  0.0 1268524 12204 ?       Sl   16:03   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id b94c7e9ecdd29b3a2365078c4a47938ea5fbe8f5d89f5261d350f0b447fbe1d8 -address /run/containerd/containerd.sock
root       71752  0.2  0.0 1268268 12132 ?       Sl   15:31   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 5f08ef93dd688ad8af7f65837aa658d525b8da6299748d58c8e7200815fb7464 -address /run/containerd/containerd.sock
root       65861  0.3  0.0 1268268 12104 ?       Sl   15:30   0:14 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id f008e49721e331bec14e2f4f657c65dc51feba6b6cb0bf8e759ce2594a1d3766 -address /run/containerd/containerd.sock
root      174716  0.2  0.0 1334388 12088 ?       Sl   15:53   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 3e074723d81db8e469113af9036facacb6118fb51d8e437a3ca2d53706d23688 -address /run/containerd/containerd.sock
root      234762  0.1  0.0 1334132 12048 ?       Sl   16:07   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id b6bc413681d56be09fe73fc7c35d43196dd36002472567b55ffa6204bbcb001b -address /run/containerd/containerd.sock
root      157898  0.1  0.0 1268268 12020 ?       Sl   15:49   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id d8288114e795a476591bebf58f3b3fd079ebbcb1b3746b9eb444388c303c34aa -address /run/containerd/containerd.sock
root       98601  0.4  0.0 1268524 12012 ?       Sl   15:38   0:17 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 60d62ed225dfb7ce152b3d545ad7bc4416bf0d46579bfde0f3796fc6103cb0cc -address /run/containerd/containerd.sock
root       43435  0.2  0.0 1268524 12008 ?       Sl   15:21   0:09 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 606b85ffaedbeba8f4f67e181a3b6bae081cd96fdcf7b253204ff990612ea37c -address /run/containerd/containerd.sock
root      190397  0.1  0.0 1334196 11988 ?       Sl   15:57   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 03c711c39bb6bbbf903080f6aa6cca0f23a03621b9739e4df363941dbe100c60 -address /run/containerd/containerd.sock
root      214504  0.1  0.0 1268268 11988 ?       Sl   16:03   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 14542e1eba2dc12d508842f9b58fb03ea493b0fd59888ccea37a1bc39907de56 -address /run/containerd/containerd.sock
root      214146  0.1  0.0 1268780 11944 ?       Sl   16:03   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 07e132675aa01fc107a90b2a84400dfb230a88784f9946857a2707c93b1e3894 -address /run/containerd/containerd.sock
root      190329  0.1  0.0 1268268 11932 ?       Sl   15:57   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 25f13e30a5e6d2d84bbe1f0bdb946226df2487617fe6020950a5920d5abe36fa -address /run/containerd/containerd.sock
root      251842  0.1  0.0 1268524 11808 ?       Sl   16:11   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id e038d44a599ed414c2d113076a0fa1b55652017e68898e7cc28061b324a5f493 -address /run/containerd/containerd.sock
root      175106  0.3  0.0 1268524 11796 ?       Sl   15:53   0:10 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 304ad92b2721826e7c182bc5b6a93f2a6aecbe6058d22d2e8ba885c0abef9902 -address /run/containerd/containerd.sock
root       67476  0.1  0.0 1268268 11788 ?       Sl   15:30   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 35c60a2df5364b2596bb82566f1a0fedb59a60e7bdbf6d5faf19ffb2962b7f75 -address /run/containerd/containerd.sock
root      172630  0.1  0.0 1268780 11760 ?       Sl   15:53   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 71a231064d801533e069be0049b0535c47538b317f70fbb3011fb310f8417130 -address /run/containerd/containerd.sock
root       49401  0.1  0.0 1268524 11716 ?       Sl   15:22   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 06277dff11d007077ffcb9ad5254b6a83d607f1cc2a8789e408de1ab7404e402 -address /run/containerd/containerd.sock
root       57846  0.2  0.0 1268524 11708 ?       Sl   15:27   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 1bd016bf89eb4a8e91f5077edcf9a0419d63cb71558d8f4784d4ef742b98ad5e -address /run/containerd/containerd.sock
root       58834  0.1  0.0 1268780 11684 ?       Sl   15:27   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 0f261446c2994863cdd0da433fc078c9b514164a0a12b9574e50eadf28dde10c -address /run/containerd/containerd.sock
root       95224  0.1  0.0 1333876 11668 ?       Sl   15:38   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 89164bc99986a8c80529a9d0fb3153c450b62967f55b3c46da2137ac9661d22e -address /run/containerd/containerd.sock
root      111517  0.1  0.0 1268524 11664 ?       Sl   15:41   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 11ddd9a9beb575a9fef036e2e84dcdf87dfd8ddda754063592446883181436f7 -address /run/containerd/containerd.sock
root       42136  0.1  0.0 1268524 11644 ?       Sl   15:20   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ee3ffcae195f6313054b7339c99bd3ae95ad96e7a1e71fbb14454c438b2214c2 -address /run/containerd/containerd.sock
root       42652  0.1  0.0 1268012 11624 ?       Sl   15:20   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 96efaa59983b0fc0740095933d3d4c010cc73130156024ddd67121ae1733d04f -address /run/containerd/containerd.sock
root      174439  0.2  0.0 1268524 11620 ?       Sl   15:53   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ff238103316d6a510df696883d34173a38cef177b50a510e0649283d782dd160 -address /run/containerd/containerd.sock
root       64027  0.1  0.0 1268524 11612 ?       Sl   15:29   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 51aab9fcb525e5dff8984c2ab61ff4106b242fbec12643396bbadfb816740a93 -address /run/containerd/containerd.sock
root       42174  0.1  0.0 1268524 11600 ?       Sl   15:20   0:09 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id a7b3c62ddcb22a4f85c16ac406d8a00baf2585ca19dcc65e53df3a45b88519af -address /run/containerd/containerd.sock
root      129068  0.1  0.0 1268268 11588 ?       Sl   15:46   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 8cc8287d4f8b38ddca5ef7813c7c8739c8a57f4ba35f08bf5e3ddfd1f1a88cfd -address /run/containerd/containerd.sock
root      214181  0.1  0.0 1268524 11584 ?       Sl   16:03   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 05f0a56e39a710025b1de7b60184dca40dd20cce784632f3ea2260bff90bf924 -address /run/containerd/containerd.sock
root      174654  0.3  0.0 1268780 11572 ?       Sl   15:53   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 2b0226c3062faaba4603a15589d228f67c8e10299701b6e09a8aaa983710a66d -address /run/containerd/containerd.sock
root       65822  0.3  0.0 1268524 11556 ?       Sl   15:30   0:15 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id f7b750dddee2963b368cb05cbdfa67861190ff5580c031d0a7cbd13749f30533 -address /run/containerd/containerd.sock
root      174595  0.2  0.0 1268780 11556 ?       Sl   15:53   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id dec5a92a5b925f896f48266679b75f84d80d7be900b2bfaf991f91b6316e9c63 -address /run/containerd/containerd.sock
root       48488  0.1  0.0 1268268 11552 ?       Sl   15:22   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id cadcab0a75948d8074a7f074031f0dc2029b8cb64663f7ec0cd68c1d84d7027b -address /run/containerd/containerd.sock
root       44812  0.1  0.0 1268268 11540 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ee4515cd1ffcaffef23ef3900df16be538fa836da90841037b98b6054a20ca23 -address /run/containerd/containerd.sock
root       80940  0.1  0.0 1268268 11504 ?       Sl   15:34   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ac5b686ceeb978c3819fb1ef692127b0d71a5c7850cd926402db4f0a126d4fab -address /run/containerd/containerd.sock
root      160450  0.1  0.0 1268268 11500 ?       Sl   15:50   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id a0378f2055d004208cca38045e12b4d0573e5790c674a6b794ce4a3165c9a81c -address /run/containerd/containerd.sock
root      206540  0.1  0.0 1268524 11496 ?       Sl   16:01   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 68ee125fec6f638d324851005c614bdcda88a0eb9795d3a81c64203be3195aca -address /run/containerd/containerd.sock
root      108058  0.1  0.0 1268524 11492 ?       Sl   15:40   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id f1cf88f10ff6727a6047ad734d9c7d99fa40422aeef4b79ad2b06f2615bfbbc0 -address /run/containerd/containerd.sock
root      113300  0.1  0.0 1268524 11476 ?       Sl   15:42   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 3d62d5bb7c34d1a75aa71eea011168eca910b3ff5ac9a1be7b3dd1d6cf185651 -address /run/containerd/containerd.sock
root       48398  0.1  0.0 1333876 11436 ?       Sl   15:22   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 4c68116b6a06e74351efb6da8b97bc1fd44dc416005e8fb891d4ce5013a2122a -address /run/containerd/containerd.sock
root       63734  0.3  0.0 1268268 11436 ?       Sl   15:29   0:15 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 5207dc6cb83975bb4f42385a3e30ba91ca4b0d5bf60c24f88c986ef7b3a1e70c -address /run/containerd/containerd.sock
root      160325  0.1  0.0 1268780 11436 ?       Sl   15:50   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 8e029603ed369271891415b29e4c37f02bcc99416f91d9236c3f9df0b8661f21 -address /run/containerd/containerd.sock
root      187755  0.1  0.0 1268524 11428 ?       Sl   15:57   0:04 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 3ec1dfe15477e25f1bc98cdb13c31bee060d9fcca7536904b3bfbaeaa2bda824 -address /run/containerd/containerd.sock
root       42162  0.1  0.0 1268268 11424 ?       Sl   15:20   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id e26c51b152e7cff3fac476e111db8c296a6727a09a66c334ae7fbc058abe0791 -address /run/containerd/containerd.sock
root      126404  0.1  0.0 1268780 11420 ?       Sl   15:46   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 69f66a8f039132be0f657e952e0418bf1e455057d21b828444ebf193573e0896 -address /run/containerd/containerd.sock
root      160966  0.1  0.0 1268588 11416 ?       Sl   15:50   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 4d84ee68ee4b76089f74ad368921b3772d7c03f7d58e4b1f7b4c99db5f551fb1 -address /run/containerd/containerd.sock
root      113259  0.1  0.0 1268524 11392 ?       Sl   15:42   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 4bb247e6624371d4d1d1f93d41466dcabf2f3a4d97408b7d959333c53cb8e9c1 -address /run/containerd/containerd.sock
root       58546  0.1  0.0 1268524 11344 ?       Sl   15:27   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 0f4f785519fed96da924b84fdfa288c8448bd9c1c300ecf1d0c7fc707f8bbabb -address /run/containerd/containerd.sock
root       45718  0.1  0.0 1268268 11308 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id adf8c80d8840b863d81230fc4de9872432c71b70c0a10a3b084dd1f69397c16e -address /run/containerd/containerd.sock
root       52978  0.1  0.0 1268524 11284 ?       Sl   15:24   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id f62dfc057631ac7e09d337609cba4fcc3a104386fe1ff0c4a46192293a55f038 -address /run/containerd/containerd.sock
root       66694  0.1  0.0 1268524 11256 ?       Sl   15:30   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 7de3e431095134f611ed78bc86af2f7e2a96a09929c45416cdb3040b79229f28 -address /run/containerd/containerd.sock
root      234802  0.1  0.0 1268524 11248 ?       Sl   16:07   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id bc11d8d12fb8560c4ea940167a3d8f4685b2dea175c3c1bcba71cf32bfe0a04d -address /run/containerd/containerd.sock
root       88510  0.1  0.0 1268268 11244 ?       Sl   15:36   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 13121652e64144b51e214427c4d636e0ff03b0ea31cd1ef556101ebf80885234 -address /run/containerd/containerd.sock
root       46230  0.1  0.0 1268524 11240 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 6832107ee47bcd952f268bf8872eb9f0c10945abb02f30a8faecefcc97928bf4 -address /run/containerd/containerd.sock
root       66254  0.1  0.0 1333876 11216 ?       Sl   15:30   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 927baf64af564777a177f2c15f53a6d9f13bd0b482f86ca574b0786389fb4267 -address /run/containerd/containerd.sock
root       30255  0.0  0.0 1334132 11212 ?       Sl   15:17   0:00 /usr/bin/containerd-shim-runc-v2 -namespace moby -id 47b9d9e18ea35a95cdc23a980a23ebc45706e827b2ff6740b7aac6adefb32846 -address /run/containerd/containerd.sock
root      244282  0.1  0.0 1268268 11208 ?       Sl   16:09   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id aa89abbee7889a0d9b68d2bfde9dc89145ee5d5948a6a884ee39b9693c43e935 -address /run/containerd/containerd.sock
root      233369  0.1  0.0 1268268 11196 ?       Sl   16:07   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 2677697cdb17f9d60defa98f8d993583ff56aa2a70664c29306e836629f2ac2a -address /run/containerd/containerd.sock
root      251465  0.1  0.0 1268524 11172 ?       Sl   16:11   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id eba27b3c74e6030451e23e584b5f4a631d95f6773a1ae92e5da3ac38e637d413 -address /run/containerd/containerd.sock
root      262981  0.1  0.0 1268524 11156 ?       Sl   16:14   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 5bde1090e6dbd01f97f37dfe3161a0b428ddb4d23f1b5d75b2172df58a3dee45 -address /run/containerd/containerd.sock
root       46313  0.1  0.0 1268524 11136 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 653add351c8d1fd0644cb885fa8508faa0d0cb58ec56677fe82ab8b15ac12aed -address /run/containerd/containerd.sock
root      228425  0.1  0.0 1268268 11128 ?       Sl   16:06   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 6abf08d8929213ee15ee449c6d38e3a8d7ba485935df7c8164ed0e32b04e26c5 -address /run/containerd/containerd.sock
root      156914  0.1  0.0 1268268 11120 ?       Sl   15:49   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id fcbb2c71dfb6582f78ce2c303211beec1e02bf278d83fd0a275f1ab049ce1f8e -address /run/containerd/containerd.sock
root       63848  0.1  0.0 1268268 11104 ?       Sl   15:29   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id a00d711e5089a3c01a45d8bd33dceb9bee7fdb388481895686670032381bbf88 -address /run/containerd/containerd.sock
root      175060  0.1  0.0 1268524 11096 ?       Sl   15:53   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 77721095e33a5be43f230d05eae25699ef32bb24703062095496665379a68353 -address /run/containerd/containerd.sock
root       58493  0.1  0.0 1268524 11092 ?       Sl   15:27   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 1d8fe682d4ef07201cb690e00f8a94b425a3c9fd4f8db64da1e95d33f4199e96 -address /run/containerd/containerd.sock
root       42081  0.1  0.0 1268268 11056 ?       Sl   15:20   0:09 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 5a95cc96815372b507fca4bad1f7b3a5070ac4eefecd6b2c5f9f9796f9a15034 -address /run/containerd/containerd.sock
root       49502  0.1  0.0 1268524 11052 ?       Sl   15:22   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 8bb1f43c4aed7e27b8cdd8e69c753c1250fec8f1a13b1d3936bcbb5c8d75ef85 -address /run/containerd/containerd.sock
root      230645  0.1  0.0 1268780 11020 ?       Sl   16:06   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 65a4fa0d00f882c0637b00856634db0ef2f80514e6b22c7605b1583fcdf36042 -address /run/containerd/containerd.sock
root       65767  0.2  0.0 1268268 10996 ?       Sl   15:30   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id dae25c7cc9422e390d99ac68e3007793154c3e774132be8df41b25cb8c8a25cf -address /run/containerd/containerd.sock
root      126365  0.1  0.0 1268524 10972 ?       Sl   15:46   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id e5e29fb54e8464f1ddf6fa261c08b68d9ad9fcbfb3b1a127e76f0bbfd434b0ee -address /run/containerd/containerd.sock
root      267165  0.1  0.0 1268524 10968 ?       Sl   16:14   0:02 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 3175b032c4f7cc597991fe2a2d32b3569eaadfc5fccefae026b977e9f443b74c -address /run/containerd/containerd.sock
root      109555  0.1  0.0 1268268 10956 ?       Sl   15:41   0:06 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ae11488c970d729fcd61b41bcb8082eb7e0e6447cf143bb05636b9d13032bf36 -address /run/containerd/containerd.sock
root      265691  0.1  0.0 1268524 10908 ?       Sl   16:14   0:02 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id a7241af191cde78909bc7250046d36835725d8fb90c2ec649013378b56c28bdc -address /run/containerd/containerd.sock
root       34801  0.0  0.0 1268268 10892 ?       Sl   15:18   0:00 /usr/bin/containerd-shim-runc-v2 -namespace moby -id 94c7d1d525324c1bc51aa76f92c2d19c77b5b65211d5694868bfd9e6b1018758 -address /run/containerd/containerd.sock
root       58598  0.1  0.0 1268524 10892 ?       Sl   15:27   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id c096db68cc35759259ec6362c55493b4adbd5d68165c5f3d52f7f535bc096800 -address /run/containerd/containerd.sock
root      174506  0.1  0.0 1268524 10892 ?       Sl   15:53   0:05 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 1ab4450faac19840bc1d799e7fa052a4253f92d639f5942d2ebc23f8cff870fb -address /run/containerd/containerd.sock
root      244668  0.1  0.0 1268268 10892 ?       Sl   16:09   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 50fc46db2b2e81ff17bcb34847246d8dcfb97e680c772168dfe1f98db16ec304 -address /run/containerd/containerd.sock
root       49871  0.1  0.0 1268268 10864 ?       Sl   15:22   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 6bac9602037e3d72c8ef3f062f2e44aafe15a1961916b1a91c5929a3b00c0dd2 -address /run/containerd/containerd.sock
root       43444  0.1  0.0 1268268 10848 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id b3b9790ae198d0effb5df92558ccf721dc7d84c70f7c408222663b7120a3e982 -address /run/containerd/containerd.sock
root       12925  0.0  0.0 1333876 10840 ?       Sl   15:13   0:01 /usr/bin/containerd-shim-runc-v2 -namespace moby -id 10555468e9d25a2f9c32ba06dc958903cdd3ee006206a93250a96fbb5f54f324 -address /run/containerd/containerd.sock
root       46274  0.1  0.0 1268524 10816 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id a49dc2fb2db4bd362699d4a588ffa52968ac9954678015feb392b85c5f1ce86f -address /run/containerd/containerd.sock
root       82398  0.1  0.0 1268524 10748 ?       Sl   15:34   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 2b5180f15ad55503178cdab5f28835fafceebb52b29c25fee12d423e59decd9c -address /run/containerd/containerd.sock
root      229467  0.1  0.0 1268524 10748 ?       Sl   16:06   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 8624e2f97c47fa7edcaa7e7e6e0120ed789dacee01dc5bc48adf2bea6b2dae2d -address /run/containerd/containerd.sock
root       45296  0.1  0.0 1268268 10740 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 63f787d81e1c02798645d94c73aa12cf1b17415059aa934ae8bce3834e2323d0 -address /run/containerd/containerd.sock
root       42140  0.1  0.0 1268524 10724 ?       Sl   15:20   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id ca6b9126f2d1f9f00bb11ca9b0f36fb88537085b6086cdfb5c4bb6ec5846cb58 -address /run/containerd/containerd.sock
root       18992  0.0  0.0 1268524 10704 ?       Sl   15:14   0:01 /usr/bin/containerd-shim-runc-v2 -namespace moby -id 43def88febf5e8e33f3c4398bed7550b064b0f662e6cfd040c81f4881c33fb84 -address /run/containerd/containerd.sock
root      231825  0.1  0.0 1268268 10648 ?       Sl   16:06   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 0afc4919be5c9f6c70d16e896954bd2ec92c2764a3a6ac0121a8ed6ac02efcf4 -address /run/containerd/containerd.sock
root       25578  0.0  0.0 1268524 10604 ?       Sl   15:17   0:00 /usr/bin/containerd-shim-runc-v2 -namespace moby -id 6adcd7536a41478752c78980feebc94f81cbb7d1647b25b0e0a9f858b3fb121f -address /run/containerd/containerd.sock
root       12580  0.0  0.0 1268268 10564 ?       Sl   15:13   0:02 /usr/bin/containerd-shim-runc-v2 -namespace moby -id bb3c98dfe26c386352485b28c8a0e3e6202920fbdacf401ab4271bc12e672280 -address /run/containerd/containerd.sock
root       45259  0.1  0.0 1268524 10476 ?       Sl   15:21   0:08 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 0cef0ff614f8d153a2e6adce3a372b2ca016f758de418a670de63e0b2427103c -address /run/containerd/containerd.sock
root       66991  0.1  0.0 1268524 10404 ?       Sl   15:30   0:07 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id 6a9e9c3e194897a6d0454cafa111a2c4a4dba766deabc5eaf7c9dce15552a94b -address /run/containerd/containerd.sock
root       39555  0.0  0.0 1268524 10308 ?       Sl   15:19   0:00 /usr/bin/containerd-shim-runc-v2 -namespace moby -id b2e0e8b526e9ef6bf7cb51fababcd337fc3d8018141be91e2a4473e2ca8fb85b -address /run/containerd/containerd.sock
root         710  0.0  0.0  16768 10256 ?        Ss   15:10   0:00 sshd: zuul [priv]
root      247391  0.1  0.0 1268524 10256 ?       Sl   16:10   0:03 /usr/bin/containerd-shim-runc-v2 -namespace k8s.io -id e2f1ef9e5de3b047cf48e3aaab2c492a0655c3a325bc2800c0151db68e8d50dd -address /run/containerd/containerd.sock
root       21951  0.0  0.0  16768 10184 ?        Ss   15:16   0:00 sshd: cephadm [priv]
root        1618  0.0  0.0  16768 10148 ?        Ss   15:11   0:00 sshd: zuul [priv]
nobody     69380  0.0  0.0 1234716 10000 ?       Ssl  15:30   0:00 /bin/memcached_exporter --memcached.address=localhost:11211 --web.listen-address=0.0.0.0:9150
nobody     69460  0.0  0.0 1234460 9592 ?        Ssl  15:30   0:00 /bin/memcached_exporter --memcached.address=localhost:11211 --web.listen-address=0.0.0.0:9150
root      269871  0.0  0.0  27848  9312 ?        Ss   16:15   0:00 keepalived -f /etc/keepalived/keepalived.conf --dont-fork --log-console --log-detail --dump-conf
root         651  0.0  0.0  15440  9264 ?        Ss   15:06   0:00 sshd: /usr/sbin/sshd -D [listener] 0 of 10-100 startups
systemd+     527  0.0  0.0  16916  9080 ?        Ss   15:06   0:01 /lib/systemd/systemd-networkd
zuul        1631  0.1  0.0  18052  9016 ?        S    15:11   0:09 sshd: zuul@notty
root      265779  0.0  0.0  17024  8920 ?        Ss   16:14   0:00 apache2 -DFOREGROUND
42424     188733  0.0  0.0 1132648 8300 ?        Ssl  15:57   0:00 haproxy -f /var/lib/neutron/ns-metadata-proxy/a5c6463c-04c0-41d2-bc42-d33e7c647780.conf
root      191158  0.0  0.0  12164  8252 ?        Ss   15:57   0:00 sshd: /usr/sbin/sshd -D -e -o Port=8022 [listener] 0 of 10-100 startups
42424     208785  0.0  0.0 1132648 8144 ?        Ssl  16:01   0:00 haproxy -f /var/lib/neutron/ns-metadata-proxy/09b3dd91-6bd3-4fde-8ae9-a0f7d5459a58.conf
zuul         728  0.0  0.0  17636  8104 ?        S    15:10   0:00 sshd: zuul@notty
cephadm    22024  0.0  0.0  17380  8004 ?        S    15:16   0:02 sshd: cephadm@notty
root         627  0.0  0.0  15520  7432 ?        Ss   15:06   0:01 /lib/systemd/systemd-logind
root         654  0.0  0.0 235404  7128 ?        Ssl  15:06   0:01 /usr/libexec/polkitd --no-debug
root         402  0.1  0.0  25592  6264 ?        Ss   15:06   0:06 /lib/systemd/systemd-udevd
nobody     48812  0.0  0.0  15364  6260 ?        Ssl  15:22   0:01 /server
systemd+  265315  0.0  0.0 118128  6204 ?        S    16:14   0:00 nginx: cache manager process
root      375321  0.0  0.0  11800  5784 ?        S    16:31   0:00 sudo /var/lib/openstack/bin/neutron-rootwrap-daemon /etc/neutron/rootwrap.conf
root      188674  0.0  0.0  11812  5768 ?        S    15:57   0:00 sudo /var/lib/openstack/bin/neutron-rootwrap-daemon /etc/neutron/rootwrap.conf
zuul        1622  0.4  0.0  15380  5624 ?        Ss   15:11   0:24 ssh: /home/zuul/.ansible/cp/199.204.45.20-22-zuul [mux]
systemd+   67153  0.0  0.0   8392  5588 ?        Ss   15:30   0:00 nginx: master process nginx -g daemon off;
root      408841  0.0  0.0  11472  5360 ?        S    16:39   0:00 sudo -H -S -n -u root /bin/sh -c echo BECOME-SUCCESS-bhqwhnhvqailtrpflaymncrtlhkndgdk ; /usr/bin/python3
42424     185388  0.0  0.0  10936  4820 ?        S    15:56   0:00 ovsdb-client monitor tcp:127.0.0.1:6640 Interface name,ofport,external_ids --format=json
root      408866  0.0  0.0  12032  4592 ?        R    16:39   0:00 ps aux --sort=-%mem
cephadm    22011  0.0  0.0 170076  4576 ?        S    15:16   0:00 (sd-pam)
11211      67610  0.0  0.0 411644  4440 ?        Ssl  15:30   0:00 memcached -m 1024 --extended=modern,track_sizes -I 5m -c 16384 -v -u 11211
message+     620  0.1  0.0   8928  4328 ?        Ss   15:06   0:06 @dbus-daemon --system --address=systemd: --nofork --nopidfile --systemd-activation --syslog-only
systemd+   67168  0.0  0.0  10160  4276 ?        S    15:30   0:00 nginx: worker process
systemd+   67170  0.0  0.0  10152  4268 ?        S    15:30   0:01 nginx: worker process
systemd+   67171  0.0  0.0  10152  4268 ?        S    15:30   0:01 nginx: worker process
systemd+   67169  0.0  0.0  10148  4264 ?        S    15:30   0:01 nginx: worker process
ubuntu     50711  0.0  0.0 1227524 4180 ?        Ssl  15:23   0:03 /opt/percona/peer-list -on-change=/opt/percona/haproxy_add_pxc_nodes.sh -service=percona-xtradb-pxc -protocol=$(PEER_LIST_SRV_PROTOCOL)
root       44385  0.0  0.0 1230020 3892 ?        Sl   15:21   0:00 cilium-health-responder --listen 4240 --pidfile /var/run/cilium/state/health-endpoint.pid
systemd+   67172  0.0  0.0  10148  3852 ?        S    15:30   0:00 nginx: worker process
42424     175670  0.0  0.0   4472  3708 ?        Ss   15:53   0:00 /bin/bash /tmp/neutron-netns-cleanup-cron.sh
root      187648  0.0  0.0   4468  3600 ?        Ss   15:57   0:00 /bin/bash /tmp/libvirt.sh
_chrony    11099  0.0  0.0  18912  3548 ?        S    15:12   0:00 /usr/sbin/chronyd -F 1
root      408845  0.0  0.0   7764  3448 ?        S    16:39   0:00 /bin/bash -c set -x systemd-cgls --full --all --no-pager > /tmp/logs/system/systemd-cgls.txt ip addr > /tmp/logs/system/ip-addr.txt ip route > /tmp/logs/system/ip-route.txt lsblk > /tmp/logs/system/lsblk.txt mount > /tmp/logs/system/mount.txt docker images > /tmp/logs/system/docker-images.txt brctl show > /tmp/logs/system/brctl-show.txt ip neigh > /tmp/logs/system/ip-neigh.txt bridge fdb show > /tmp/logs/system/bridge-fdb.txt ps aux --sort=-%mem > /tmp/logs/system/ps.txt dpkg -l > /tmp/logs/system/packages.txt CONTAINERS=($(docker ps -a --format '{{ .Names }}' --filter label=zuul)) if [ ! -z "$CONTAINERS" ]; then   mkdir -p "/tmp/logs/system/containers"   for CONTAINER in ${CONTAINERS}; do     docker logs "${CONTAINER}" > "/tmp/logs/system/containers/${CONTAINER}.txt"   done fi
root       99153  0.0  0.0   4384  3276 ?        Ss   15:38   0:00 /bin/bash -x -e -m -c  CEPH_CLIENT_ID=ceph-client.rgw.ceph.a PERIODICITY=daily LOG_ROTATE_CEPH_FILE=/etc/logrotate.d/ceph LOG_MAX_SIZE=500M ROTATE=7  # edit the logrotate file to only rotate a specific daemon log # otherwise we will logrotate log files without reloading certain daemons # this might happen when multiple daemons run on the same machine sed -i "s|*.log|$CEPH_CLIENT_ID.log|" "$LOG_ROTATE_CEPH_FILE"  # replace default daily with given user input sed --in-place "s/daily/$PERIODICITY/g" "$LOG_ROTATE_CEPH_FILE"  # replace rotate count, default 7 for all ceph daemons other than rbd-mirror sed --in-place "s/rotate 7/rotate $ROTATE/g" "$LOG_ROTATE_CEPH_FILE"  if [ "$LOG_MAX_SIZE" != "0" ]; then ?# adding maxsize $LOG_MAX_SIZE at the 4th line of the logrotate config file with 4 spaces to maintain indentation ?sed --in-place "4i \ \ \ \ maxsize $LOG_MAX_SIZE" "$LOG_ROTATE_CEPH_FILE" fi  while true; do ?# we don't force the logrorate but we let the logrotate binary handle the rotation based on user's input for periodicity and size ?logrotate --verbose "$LOG_ROTATE_CEPH_FILE" ?sleep 15m done 
root      269885  0.0  0.0  27976  3012 ?        S    16:15   0:00 keepalived -f /etc/keepalived/keepalived.conf --dont-fork --log-console --log-detail --dump-conf
zuul         714  0.0  0.0 168464  2940 ?        S    15:10   0:00 (sd-pam)
root       34507  0.0  0.0   7764  2508 ?        Ss   15:18   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.2/unit.run
root       12491  0.0  0.0   7764  2476 ?        Ss   15:13   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/mon.instance/unit.run
root       12855  0.0  0.0   7764  2472 ?        Ss   15:13   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/mgr.instance.osyhqi/unit.run
root       29973  0.0  0.0   7764  2472 ?        Ss   15:17   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.1/unit.run
root       25292  0.0  0.0   7764  2448 ?        Ss   15:17   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/osd.0/unit.run
root       18949  0.0  0.0   7764  2424 ?        Ss   15:14   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/crash.instance/unit.run
root       39503  0.0  0.0   7764  2324 ?        Ss   15:19   0:00 /bin/bash /var/lib/ceph/4837cbf8-4f90-4300-b3f6-726c9b9f89b4/ceph-exporter.instance/unit.run
999       172774  0.0  0.0   2904  1956 ?        Ss   15:53   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999       187903  0.0  0.0   2908  1904 ?        Ss   15:57   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999        95415  0.0  0.0   2900  1896 ?        Ss   15:38   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999       158032  0.0  0.0   2904  1896 ?        Ss   15:49   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999       111667  0.0  0.0   2900  1888 ?        Ss   15:41   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999       226322  0.0  0.0   2908  1856 ?        Ss   16:05   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999        70059  0.0  0.0   2896  1808 ?        Ss   15:30   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999       206680  0.0  0.0   2908  1776 ?        Ss   16:01   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999        81103  0.0  0.0   2900  1752 ?        Ss   15:34   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
999       247573  0.0  0.0   2912  1744 ?        Ss   16:10   0:00 /bin/sh /opt/rabbitmq/sbin/rabbitmq-server
uuidd       1095  0.0  0.0   9628  1504 ?        Ss   15:10   0:00 /usr/sbin/uuidd --socket-activation
root      406219  0.0  0.0   4940  1340 ?        S+   16:38   0:00 /usr/bin/coreutils --coreutils-prog-shebang=sleep /usr/bin/sleep 15m
999       111805  0.0  0.0   3740  1300 ?        Ss   15:41   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       206849  0.0  0.0   3748  1300 ?        Ss   16:01   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       247807  0.0  0.0   3752  1300 ?        Ss   16:10   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       158177  0.0  0.0   3744  1296 ?        Ss   15:49   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999        70157  0.0  0.0   3736  1284 ?        Ss   15:30   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       172917  0.0  0.0   3748  1268 ?        Ss   15:53   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999        95546  0.0  0.0   3740  1264 ?        Ss   15:38   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       226467  0.0  0.0   3748  1264 ?        Ss   16:05   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       188140  0.0  0.0   3748  1252 ?        Ss   15:57   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999        81196  0.0  0.0   3740  1216 ?        Ss   15:34   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
root         636  0.0  0.0   6220  1172 ttyS0    Ss+  15:06   0:00 /sbin/agetty -o -p -- \u --keep-baud 115200,57600,38400,9600 ttyS0 vt220
root      155421  0.0  0.0   2572  1128 ?        Ss   15:49   0:00 /tini -s -- /tmp/openvswitch-vswitchd.sh start
42424     397318  0.0  0.0   2712  1112 ?        S    16:35   0:00 sleep 300
root         635  0.0  0.0   6176  1084 tty1     Ss+  15:06   0:00 /sbin/agetty -o -p -- \u --noclear tty1 linux
999       172912  0.0  0.0   2660  1068 ?        Ss   15:53   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       158170  0.0  0.0   2656  1060 ?        Ss   15:49   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999        70082  0.0  0.0   2784  1032 ?        Ss   15:30   0:00 erl_child_setup 1048576
999       158350  0.0  0.0   2904  1028 ?        Ss   15:49   0:00 /bin/sh -s rabbit_disk_monitor
999       226726  0.0  0.0   2908  1028 ?        Ss   16:05   0:00 /bin/sh -s rabbit_disk_monitor
999       188473  0.0  0.0   2908  1024 ?        Ss   15:57   0:00 /bin/sh -s rabbit_disk_monitor
999        95891  0.0  0.0   2900  1016 ?        Ss   15:38   0:00 /bin/sh -s rabbit_disk_monitor
999       111980  0.0  0.0   2900  1016 ?        Ss   15:41   0:00 /bin/sh -s rabbit_disk_monitor
999       173030  0.0  0.0   2908  1016 ?        Ss   15:53   0:00 /bin/sh -s rabbit_disk_monitor
999        70336  0.0  0.0   2896  1012 ?        Ss   15:30   0:00 /bin/sh -s rabbit_disk_monitor
999        81181  0.0  0.0   2900  1012 ?        Ss   15:34   0:00 sh -s disksup
999       226395  0.0  0.0   2664  1012 ?        Ss   16:05   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       247599  0.0  0.0   2800  1012 ?        Ss   16:10   0:00 erl_child_setup 1048576
999       247957  0.0  0.0   2912  1012 ?        Ss   16:10   0:00 /bin/sh -s rabbit_disk_monitor
999       172797  0.0  0.0   2796  1008 ?        Ss   15:53   0:00 erl_child_setup 1048576
999       206825  0.0  0.0   2792  1008 ?        Ss   16:01   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
zuul      408839  0.0  0.0   2892  1008 ?        Ss   16:39   0:00 sh -c /bin/sh -c 'sudo -H -S -n  -u root /bin/sh -c '"'"'echo BECOME-SUCCESS-bhqwhnhvqailtrpflaymncrtlhkndgdk ; /usr/bin/python3'"'"' && sleep 0'
999       206824  0.0  0.0   2660  1004 ?        Ss   16:01   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       207064  0.0  0.0   2908  1000 ?        Ss   16:01   0:00 /bin/sh -s rabbit_disk_monitor
zuul      408840  0.0  0.0   2892  1000 ?        S    16:39   0:00 /bin/sh -c sudo -H -S -n  -u root /bin/sh -c 'echo BECOME-SUCCESS-bhqwhnhvqailtrpflaymncrtlhkndgdk ; /usr/bin/python3' && sleep 0
999        70153  0.0  0.0   2896   996 ?        Ss   15:30   0:00 sh -s disksup
999        81130  0.0  0.0   2788   996 ?        Ss   15:34   0:00 erl_child_setup 1048576
999        95523  0.0  0.0   2652   996 ?        Ss   15:38   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       187986  0.0  0.0   2792   996 ?        Ss   15:57   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       206703  0.0  0.0   2796   996 ?        Ss   16:01   0:00 erl_child_setup 1048576
999       247668  0.0  0.0   2796   996 ?        Ss   16:10   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       172913  0.0  0.0   2792   992 ?        Ss   15:53   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       247665  0.0  0.0   2912   992 ?        Ss   16:10   0:00 sh -s disksup
999        81296  0.0  0.0   2900   988 ?        Ss   15:34   0:00 /bin/sh -s rabbit_disk_monitor
999       226393  0.0  0.0   2908   988 ?        Ss   16:05   0:00 sh -s disksup
root      408842  0.0  0.0   2892   988 ?        S    16:39   0:00 /bin/sh -c echo BECOME-SUCCESS-bhqwhnhvqailtrpflaymncrtlhkndgdk ; /usr/bin/python3
999        70156  0.0  0.0   2780   984 ?        Ss   15:30   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       158171  0.0  0.0   2788   984 ?        Ss   15:49   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       172910  0.0  0.0   2908   984 ?        Ss   15:53   0:00 sh -s disksup
999       187926  0.0  0.0   2796   984 ?        Ss   15:57   0:00 erl_child_setup 1048576
999        70155  0.0  0.0   2648   980 ?        Ss   15:30   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       158055  0.0  0.0   2792   980 ?        Ss   15:49   0:00 erl_child_setup 1048576
999       206822  0.0  0.0   2908   980 ?        Ss   16:01   0:00 sh -s disksup
999       247667  0.0  0.0   2664   980 ?        Ss   16:10   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999        95521  0.0  0.0   2900   976 ?        Ss   15:38   0:00 sh -s disksup
999       111737  0.0  0.0   2900   968 ?        Ss   15:41   0:00 sh -s disksup
999       111739  0.0  0.0   2652   968 ?        Ss   15:41   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       158168  0.0  0.0   2904   968 ?        Ss   15:49   0:00 sh -s disksup
999       226396  0.0  0.0   2796   968 ?        Ss   16:05   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999        81183  0.0  0.0   2652   964 ?        Ss   15:34   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       187985  0.0  0.0   2660   964 ?        Ss   15:57   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/memsup
999       187983  0.0  0.0   2908   960 ?        Ss   15:57   0:00 sh -s disksup
999        95439  0.0  0.0   2788   952 ?        Ss   15:38   0:00 erl_child_setup 1048576
999        95524  0.0  0.0   2784   948 ?        Ss   15:38   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       111690  0.0  0.0   2788   948 ?        Ss   15:41   0:00 erl_child_setup 1048576
999       111740  0.0  0.0   2784   948 ?        Ss   15:41   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999        81184  0.0  0.0   2784   944 ?        Ss   15:34   0:00 /opt/erlang/lib/erlang/lib/os_mon-2.9.1/priv/bin/cpu_sup
999       226346  0.0  0.0   2796   944 ?        Ss   16:05   0:00 erl_child_setup 1048576
root      145649  0.0  0.0  12932   748 ?        Ss   15:48   0:00 /sbin/iscsid
ubuntu     50940  0.0  0.0 1226068  668 ?        Sl   15:23   0:00 /var/lib/mysql/mysql-state-monitor
nobody    208782  0.0  0.0  11916   552 ?        S    16:01   0:00 dnsmasq --no-hosts --no-resolv --pid-file=/var/lib/neutron/dhcp/09b3dd91-6bd3-4fde-8ae9-a0f7d5459a58/pid --dhcp-hostsfile=/var/lib/neutron/dhcp/09b3dd91-6bd3-4fde-8ae9-a0f7d5459a58/host --addn-hosts=/var/lib/neutron/dhcp/09b3dd91-6bd3-4fde-8ae9-a0f7d5459a58/addn_hosts --dhcp-optsfile=/var/lib/neutron/dhcp/09b3dd91-6bd3-4fde-8ae9-a0f7d5459a58/opts --dhcp-leasefile=/var/lib/neutron/dhcp/09b3dd91-6bd3-4fde-8ae9-a0f7d5459a58/leases --dhcp-match=set:ipxe,175 --dhcp-userclass=set:ipxe6,iPXE --local-service --bind-dynamic --dhcp-range=set:subnet-846f9922-c6a7-44fb-92d5-54d9bd5e302d,172.24.0.0,static,255.255.252.0,86400s --dhcp-option-force=option:mtu,1450 --dhcp-lease-max=1024 --conf-file=/etc/neutron/dnsmasq.conf --server=10.96.0.20 --domain=openstacklocal
nobody    188721  0.0  0.0  11916   548 ?        S    15:57   0:00 dnsmasq --no-hosts --no-resolv --pid-file=/var/lib/neutron/dhcp/a5c6463c-04c0-41d2-bc42-d33e7c647780/pid --dhcp-hostsfile=/var/lib/neutron/dhcp/a5c6463c-04c0-41d2-bc42-d33e7c647780/host --addn-hosts=/var/lib/neutron/dhcp/a5c6463c-04c0-41d2-bc42-d33e7c647780/addn_hosts --dhcp-optsfile=/var/lib/neutron/dhcp/a5c6463c-04c0-41d2-bc42-d33e7c647780/opts --dhcp-leasefile=/var/lib/neutron/dhcp/a5c6463c-04c0-41d2-bc42-d33e7c647780/leases --dhcp-match=set:ipxe,175 --dhcp-userclass=set:ipxe6,iPXE --local-service --bind-dynamic --dhcp-range=set:subnet-608c7406-60cd-4c51-8f86-c4440e8847cc,10.96.250.0,static,255.255.255.0,86400s --dhcp-option-force=option:mtu,1500 --dhcp-lease-max=256 --conf-file=/etc/neutron/dnsmasq.conf --server=10.96.0.20 --domain=openstacklocal
_chrony    11100  0.0  0.0  10584   544 ?        S    15:12   0:00 /usr/sbin/chronyd -F 1
999       226468  0.0  0.0   3748   132 ?        S    16:05   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       247808  0.0  0.0   3752   132 ?        S    16:10   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       188141  0.0  0.0   3748   128 ?        S    15:57   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       206850  0.0  0.0   3748   128 ?        S    16:01   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       158178  0.0  0.0   3744   124 ?        S    15:49   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       172918  0.0  0.0   3748   124 ?        S    15:53   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       226479  0.0  0.0   3756   124 ?        S    16:05   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999       247818  0.0  0.0   3760   124 ?        S    16:10   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999        95547  0.0  0.0   3740   120 ?        S    15:38   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       111806  0.0  0.0   3740   120 ?        S    15:41   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       188151  0.0  0.0   3756   120 ?        S    15:57   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999       206860  0.0  0.0   3756   120 ?        S    16:01   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999        70158  0.0  0.0   3736   116 ?        S    15:30   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999        81197  0.0  0.0   3740   116 ?        S    15:34   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/inet_gethost 4
999       158188  0.0  0.0   3752   116 ?        S    15:49   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999       172928  0.0  0.0   3756   116 ?        S    15:53   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999        81207  0.0  0.0   3748   112 ?        S    15:34   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999        95557  0.0  0.0   3748   112 ?        S    15:38   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999       111829  0.0  0.0   3748   112 ?        S    15:41   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
999        70168  0.0  0.0   3744   108 ?        S    15:30   0:00 /opt/erlang/lib/erlang/erts-14.2.5.1/bin/epmd -daemon
root       12605  0.0  0.0   1048     4 ?        Ss   15:13   0:00 /sbin/docker-init -- /usr/bin/ceph-mon -n mon.instance -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug  --default-mon-cluster-log-to-file=false --default-mon-cluster-log-to-stderr=true
root       12966  0.0  0.0   1048     4 ?        Ss   15:13   0:00 /sbin/docker-init -- /usr/bin/ceph-mgr -n mgr.instance.osyhqi -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       19020  0.0  0.0   1048     4 ?        Ss   15:14   0:00 /sbin/docker-init -- /usr/bin/ceph-crash -n client.crash.instance
root       25602  0.0  0.0   1048     4 ?        Ss   15:17   0:00 /sbin/docker-init -- /usr/bin/ceph-osd -n osd.0 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       30280  0.0  0.0   1048     4 ?        Ss   15:17   0:00 /sbin/docker-init -- /usr/bin/ceph-osd -n osd.1 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       34826  0.0  0.0   1048     4 ?        Ss   15:18   0:00 /sbin/docker-init -- /usr/bin/ceph-osd -n osd.2 -f --setuser ceph --setgroup ceph --default-log-to-file=false --default-log-to-stderr=true --default-log-stderr-prefix=debug 
root       39586  0.0  0.0   1048     4 ?        Ss   15:19   0:00 /sbin/docker-init -- /usr/bin/ceph-exporter -n client.ceph-exporter.instance -f --sock-dir=/var/run/ceph/ --addrs=0.0.0.0 --port=9926 --prio-limit=5 --stats-period=5
65535      42115  0.0  0.0   1028     4 ?        Ss   15:20   0:00 /pause
65535      42218  0.0  0.0   1028     4 ?        Ss   15:20   0:00 /pause
65535      42245  0.0  0.0   1028     4 ?        Ss   15:20   0:00 /pause
65535      42246  0.0  0.0   1028     4 ?        Ss   15:20   0:00 /pause
65535      42264  0.0  0.0   1028     4 ?        Ss   15:20   0:00 /pause
65535      42676  0.0  0.0   1028     4 ?        Ss   15:20   0:00 /pause
65535      43478  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      43491  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      44834  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      45282  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      45320  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      45743  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      46254  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      46298  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      46339  0.0  0.0   1028     4 ?        Ss   15:21   0:00 /pause
65535      48424  0.0  0.0   1028     4 ?        Ss   15:22   0:00 /pause
65535      48511  0.0  0.0   1028     4 ?        Ss   15:22   0:00 /pause
systemd+   48727  0.0  0.0    224     4 ?        Ss   15:22   0:00 /usr/bin/dumb-init -- /nginx-ingress-controller --default-backend-service=ingress-nginx/ingress-nginx-defaultbackend --publish-service=ingress-nginx/ingress-nginx-controller --election-id=ingress-nginx-leader --controller-class=k8s.io/ingress-nginx --ingress-class=atmosphere --configmap=ingress-nginx/ingress-nginx-controller --tcp-services-configmap=ingress-nginx/ingress-nginx-tcp --udp-services-configmap=ingress-nginx/ingress-nginx-udp --validating-webhook=:7443 --validating-webhook-certificate=/usr/local/certificates/cert --validating-webhook-key=/usr/local/certificates/key --enable-metrics=true
65535      49427  0.0  0.0   1028     4 ?        Ss   15:22   0:00 /pause
65535      49528  0.0  0.0   1028     4 ?        Ss   15:22   0:00 /pause
65535      49894  0.0  0.0   1028     4 ?        Ss   15:22   0:00 /pause
65535      50191  0.0  0.0   1028     4 ?        Ss   15:22   0:00 /pause
65535      50604  0.0  0.0   1028     4 ?        Ss   15:23   0:00 /pause
65535      52832  0.0  0.0   1028     4 ?        Ss   15:24   0:00 /pause
65535      53001  0.0  0.0   1028     4 ?        Ss   15:24   0:00 /pause
65535      57870  0.0  0.0   1028     4 ?        Ss   15:27   0:00 /pause
65535      58518  0.0  0.0   1028     4 ?        Ss   15:27   0:00 /pause
65535      58578  0.0  0.0   1028     4 ?        Ss   15:27   0:00 /pause
65535      58622  0.0  0.0   1028     4 ?        Ss   15:27   0:00 /pause
65535      58858  0.0  0.0   1028     4 ?        Ss   15:27   0:00 /pause
nobody     63763  0.0  0.0   1028     4 ?        Ss   15:29   0:00 /pause
nobody     63871  0.0  0.0   1028     4 ?        Ss   15:29   0:00 /pause
nobody     64064  0.0  0.0   1028     4 ?        Ss   15:29   0:00 /pause
472        64088  0.0  0.0   1028     4 ?        Ss   15:29   0:00 /pause
zuul       65463  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
zuul       65541  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
systemd+   65793  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
65535      65846  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
65535      65884  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
65535      66278  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
zuul       66722  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
10001      67016  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
nobody     67499  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
nobody     68277  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
999        69740  0.0  0.0   1028     4 ?        Ss   15:30   0:00 /pause
42424      71777  0.0  0.0   1028     4 ?        Ss   15:31   0:00 /pause
999        80963  0.0  0.0   1028     4 ?        Ss   15:34   0:00 /pause
42424      82421  0.0  0.0   1028     4 ?        Ss   15:34   0:00 /pause
65535      88535  0.0  0.0   1028     4 ?        Ss   15:36   0:00 /pause
999        95247  0.0  0.0   1028     4 ?        Ss   15:38   0:00 /pause
65535      98625  0.0  0.0   1028     4 ?        Ss   15:38   0:00 /pause
65535      98669  0.0  0.0   1028     4 ?        Ss   15:38   0:00 /pause
42424     108082  0.0  0.0   1028     4 ?        Ss   15:40   0:00 /pause
42424     109580  0.0  0.0   1028     4 ?        Ss   15:41   0:00 /pause
42424     109630  0.0  0.0   1028     4 ?        Ss   15:41   0:00 /pause
999       111541  0.0  0.0   1028     4 ?        Ss   15:41   0:00 /pause
42424     113283  0.0  0.0   1028     4 ?        Ss   15:42   0:00 /pause
42424     113325  0.0  0.0   1028     4 ?        Ss   15:42   0:00 /pause
42424     126390  0.0  0.0   1028     4 ?        Ss   15:46   0:00 /pause
42424     126430  0.0  0.0   1028     4 ?        Ss   15:46   0:00 /pause
42424     129093  0.0  0.0   1028     4 ?        Ss   15:46   0:00 /pause
42424     155052  0.0  0.0   1028     4 ?        Ss   15:49   0:00 /pause
root      156513  0.0  0.0   1028     4 ?        Ss   15:49   0:00 /pause
65535     156936  0.0  0.0   1028     4 ?        Ss   15:49   0:00 /pause
999       157924  0.0  0.0   1028     4 ?        Ss   15:49   0:00 /pause
42424     160097  0.0  0.0   1028     4 ?        Ss   15:50   0:00 /pause
42424     160238  0.0  0.0   1028     4 ?        Ss   15:50   0:00 /pause
42424     160318  0.0  0.0   1028     4 ?        Ss   15:50   0:00 /pause
42424     160369  0.0  0.0   1028     4 ?        Ss   15:50   0:00 /pause
42424     160501  0.0  0.0   1028     4 ?        Ss   15:50   0:00 /pause
42424     160997  0.0  0.0   1028     4 ?        Ss   15:50   0:00 /pause
999       172654  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     174518  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     174598  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     174648  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     174749  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     174778  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     175084  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
42424     175129  0.0  0.0   1028     4 ?        Ss   15:53   0:00 /pause
999       187777  0.0  0.0   1028     4 ?        Ss   15:57   0:00 /pause
42424     190366  0.0  0.0   1028     4 ?        Ss   15:57   0:00 /pause
42424     190429  0.0  0.0   1028     4 ?        Ss   15:57   0:00 /pause
42424     190503  0.0  0.0   1028     4 ?        Ss   15:57   0:00 /pause
999       206564  0.0  0.0   1028     4 ?        Ss   16:01   0:00 /pause
65535     214169  0.0  0.0   1028     4 ?        Ss   16:03   0:00 /pause
65535     214238  0.0  0.0   1028     4 ?        Ss   16:03   0:00 /pause
65535     214267  0.0  0.0   1028     4 ?        Ss   16:03   0:00 /pause
65535     214527  0.0  0.0   1028     4 ?        Ss   16:03   0:00 /pause
999       226219  0.0  0.0   1028     4 ?        Ss   16:05   0:00 /pause
65535     228450  0.0  0.0   1028     4 ?        Ss   16:06   0:00 /pause
65535     229503  0.0  0.0   1028     4 ?        Ss   16:06   0:00 /pause
65535     230668  0.0  0.0   1028     4 ?        Ss   16:06   0:00 /pause
65535     231847  0.0  0.0   1028     4 ?        Ss   16:06   0:00 /pause
65535     233393  0.0  0.0   1028     4 ?        Ss   16:07   0:00 /pause
65535     234786  0.0  0.0   1028     4 ?        Ss   16:07   0:00 /pause
65535     234828  0.0  0.0   1028     4 ?        Ss   16:07   0:00 /pause
42424     244309  0.0  0.0   1028     4 ?        Ss   16:09   0:00 /pause
65535     244693  0.0  0.0   1028     4 ?        Ss   16:09   0:00 /pause
999       247415  0.0  0.0   1028     4 ?        Ss   16:10   0:00 /pause
42424     251510  0.0  0.0   1028     4 ?        Ss   16:11   0:00 /pause
42424     251689  0.0  0.0   1028     4 ?        Ss   16:11   0:00 /pause
42424     251733  0.0  0.0   1028     4 ?        Ss   16:11   0:00 /pause
42424     251878  0.0  0.0   1028     4 ?        Ss   16:11   0:00 /pause
42424     263004  0.0  0.0   1028     4 ?        Ss   16:14   0:00 /pause
65535     265714  0.0  0.0   1028     4 ?        Ss   16:14   0:00 /pause
65535     267188  0.0  0.0   1028     4 ?        Ss   16:14   0:00 /pause
root           2  0.0  0.0      0     0 ?        S    15:06   0:00 [kthreadd]
root           3  0.0  0.0      0     0 ?        I<   15:06   0:00 [rcu_gp]
root           4  0.0  0.0      0     0 ?        I<   15:06   0:00 [rcu_par_gp]
root           5  0.0  0.0      0     0 ?        I<   15:06   0:00 [slub_flushwq]
root           6  0.0  0.0      0     0 ?        I<   15:06   0:00 [netns]
root           8  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/0:0H-events_highpri]
root          10  0.0  0.0      0     0 ?        I<   15:06   0:00 [mm_percpu_wq]
root          11  0.0  0.0      0     0 ?        S    15:06   0:00 [rcu_tasks_rude_]
root          12  0.0  0.0      0     0 ?        S    15:06   0:00 [rcu_tasks_trace]
root          13  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/0]
root          14  0.1  0.0      0     0 ?        I    15:06   0:07 [rcu_sched]
root          15  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/0]
root          16  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/0]
root          18  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/0]
root          19  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/1]
root          20  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/1]
root          21  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/1]
root          22  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/1]
root          24  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/1:0H-events_highpri]
root          25  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/2]
root          26  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/2]
root          27  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/2]
root          28  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/2]
root          30  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/2:0H-events_highpri]
root          31  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/3]
root          32  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/3]
root          33  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/3]
root          34  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/3]
root          36  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/3:0H-events_highpri]
root          37  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/4]
root          38  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/4]
root          39  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/4]
root          40  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/4]
root          42  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/4:0H-events_highpri]
root          43  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/5]
root          44  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/5]
root          45  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/5]
root          46  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/5]
root          48  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/5:0H-events_highpri]
root          49  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/6]
root          50  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/6]
root          51  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/6]
root          52  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/6]
root          54  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/6:0H-events_highpri]
root          55  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/7]
root          56  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/7]
root          57  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/7]
root          58  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/7]
root          60  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/7:0H-events_highpri]
root          61  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/8]
root          62  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/8]
root          63  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/8]
root          64  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/8]
root          66  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/8:0H-events_highpri]
root          67  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/9]
root          68  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/9]
root          69  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/9]
root          70  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/9]
root          72  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/9:0H-events_highpri]
root          73  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/10]
root          74  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/10]
root          75  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/10]
root          76  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/10]
root          78  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/10:0H-events_highpri]
root          79  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/11]
root          80  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/11]
root          81  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/11]
root          82  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/11]
root          84  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/11:0H-events_highpri]
root          85  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/12]
root          86  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/12]
root          87  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/12]
root          88  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/12]
root          90  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/12:0H-events_highpri]
root          91  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/13]
root          92  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/13]
root          93  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/13]
root          94  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/13]
root          96  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/13:0H-events_highpri]
root          97  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/14]
root          98  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/14]
root          99  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/14]
root         100  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/14]
root         102  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/14:0H-events_highpri]
root         103  0.0  0.0      0     0 ?        S    15:06   0:00 [cpuhp/15]
root         104  0.0  0.0      0     0 ?        S    15:06   0:00 [idle_inject/15]
root         105  0.0  0.0      0     0 ?        S    15:06   0:00 [migration/15]
root         106  0.0  0.0      0     0 ?        S    15:06   0:01 [ksoftirqd/15]
root         108  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/15:0H-events_highpri]
root         109  0.0  0.0      0     0 ?        S    15:06   0:00 [kdevtmpfs]
root         110  0.0  0.0      0     0 ?        I<   15:06   0:00 [inet_frag_wq]
root         111  0.0  0.0      0     0 ?        S    15:06   0:00 [kauditd]
root         112  0.0  0.0      0     0 ?        S    15:06   0:00 [khungtaskd]
root         113  0.0  0.0      0     0 ?        S    15:06   0:00 [oom_reaper]
root         114  0.0  0.0      0     0 ?        I<   15:06   0:00 [writeback]
root         115  0.0  0.0      0     0 ?        S    15:06   0:00 [kcompactd0]
root         116  0.0  0.0      0     0 ?        SN   15:06   0:00 [ksmd]
root         117  0.0  0.0      0     0 ?        SN   15:06   0:00 [khugepaged]
root         167  0.0  0.0      0     0 ?        I<   15:06   0:00 [kintegrityd]
root         168  0.0  0.0      0     0 ?        I<   15:06   0:00 [kblockd]
root         169  0.0  0.0      0     0 ?        I<   15:06   0:00 [blkcg_punt_bio]
root         170  0.0  0.0      0     0 ?        I<   15:06   0:00 [tpm_dev_wq]
root         171  0.0  0.0      0     0 ?        I<   15:06   0:00 [ata_sff]
root         172  0.0  0.0      0     0 ?        I<   15:06   0:00 [md]
root         173  0.0  0.0      0     0 ?        I<   15:06   0:00 [edac-poller]
root         174  0.0  0.0      0     0 ?        I<   15:06   0:00 [devfreq_wq]
root         175  0.0  0.0      0     0 ?        S    15:06   0:00 [watchdogd]
root         176  0.1  0.0      0     0 ?        I    15:06   0:07 [kworker/u32:1-flush-252:0]
root         177  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/0:1H-kblockd]
root         179  0.1  0.0      0     0 ?        S    15:06   0:07 [kswapd0]
root         180  0.0  0.0      0     0 ?        S    15:06   0:00 [ecryptfs-kthrea]
root         183  0.0  0.0      0     0 ?        I<   15:06   0:00 [kthrotld]
root         185  0.0  0.0      0     0 ?        I<   15:06   0:00 [acpi_thermal_pm]
root         187  0.0  0.0      0     0 ?        S    15:06   0:00 [scsi_eh_0]
root         188  0.0  0.0      0     0 ?        I<   15:06   0:00 [scsi_tmf_0]
root         189  0.0  0.0      0     0 ?        S    15:06   0:00 [scsi_eh_1]
root         190  0.0  0.0      0     0 ?        I<   15:06   0:00 [scsi_tmf_1]
root         192  0.0  0.0      0     0 ?        I<   15:06   0:00 [vfio-irqfd-clea]
root         202  0.0  0.0      0     0 ?        I<   15:06   0:00 [mld]
root         203  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/2:1H-kblockd]
root         204  0.0  0.0      0     0 ?        I<   15:06   0:00 [ipv6_addrconf]
root         205  0.1  0.0      0     0 ?        I    15:06   0:08 [kworker/u32:4-flush-252:0]
root         215  0.0  0.0      0     0 ?        I<   15:06   0:00 [kstrp]
root         219  0.0  0.0      0     0 ?        I<   15:06   0:00 [zswap-shrink]
root         221  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/u33:0]
root         226  0.0  0.0      0     0 ?        I<   15:06   0:00 [charger_manager]
root         248  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/11:1H-kblockd]
root         270  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/12:1H-kblockd]
root         296  0.0  0.0      0     0 ?        S    15:06   0:00 [hwrng]
root         298  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/14:1H-kblockd]
root         299  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/4:1H-kblockd]
root         300  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/9:1H-kblockd]
root         319  0.3  0.0      0     0 ?        D    15:06   0:16 [jbd2/vda1-8]
root         320  0.0  0.0      0     0 ?        I<   15:06   0:00 [ext4-rsv-conver]
root         324  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/13:1H-kblockd]
root         325  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/10:1H-kblockd]
root         326  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/6:1H-kblockd]
root         327  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/3:1H-kblockd]
root         328  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/8:1H-kblockd]
root         329  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/7:1H-kblockd]
root         330  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/15:1H-kblockd]
root         331  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/1:1H-kblockd]
root         332  0.0  0.0      0     0 ?        I<   15:06   0:00 [kworker/5:1H-kblockd]
root         459  0.0  0.0      0     0 ?        I<   15:06   0:00 [cryptd]
root        9230  0.0  0.0      0     0 ?        I<   15:11   0:00 [kdmflush]
root        9247  0.0  0.0      0     0 ?        I<   15:11   0:00 [kdmflush]
root        9263  0.0  0.0      0     0 ?        I<   15:11   0:00 [kdmflush]
root       10360  0.0  0.0      0     0 ?        I    15:12   0:04 [kworker/u32:6-ext4-rsv-conversion]
root       39364  0.0  0.0      0     0 ?        I<   15:19   0:00 [ceph-msgr]
root       39370  0.0  0.0      0     0 ?        I<   15:19   0:00 [rbd]
root       51043  0.0  0.0      0     0 ?        I<   15:23   0:00 [dio/vda1]
root       64161  0.1  0.0      0     0 ?        I    15:29   0:04 [kworker/u32:3-flush-252:0]
root       64164  0.0  0.0      0     0 ?        I    15:29   0:02 [kworker/u32:9-flush-252:0]
root       68350  0.0  0.0      0     0 ?        I    15:30   0:01 [kworker/u32:10-flush-253:1]
root      122995  0.0  0.0      0     0 ?        I    15:44   0:00 [kworker/u32:13-flush-252:0]
root      135517  0.0  0.0      0     0 ?        I<   15:48   0:00 [kmpathd]
root      135518  0.0  0.0      0     0 ?        I<   15:48   0:00 [kmpath_handlerd]
root      145680  0.0  0.0      0     0 ?        I<   15:48   0:00 [iscsi_eh]
root      145682  0.0  0.0      0     0 ?        I<   15:48   0:00 [iscsi_conn_clea]
root      155467  0.0  0.0      0     0 ?        I<   15:49   0:00 [ib-comp-wq]
root      155468  0.0  0.0      0     0 ?        I<   15:49   0:00 [ib-comp-unb-wq]
root      155469  0.0  0.0      0     0 ?        I<   15:49   0:00 [ib_mcast]
root      155470  0.0  0.0      0     0 ?        I<   15:49   0:00 [ib_nl_sa_wq]
root      183511  0.0  0.0      0     0 ?        I    15:56   0:02 [kworker/u32:14-flush-252:0]
root      186752  0.0  0.0      0     0 ?        I    15:56   0:01 [kworker/u32:15-flush-252:0]
root      187102  0.0  0.0      0     0 ?        I    15:56   0:01 [kworker/u32:16-flush-252:0]
root      204757  0.0  0.0      0     0 ?        I    16:00   0:00 [kworker/5:0-events]
root      218194  0.0  0.0      0     0 ?        I    16:03   0:00 [kworker/7:4-events]
root      225828  0.0  0.0      0     0 ?        I    16:05   0:00 [kworker/6:0-rcu_gp]
root      225829  0.0  0.0      0     0 ?        I    16:05   0:01 [kworker/u32:12-flush-252:0]
root      239560  0.0  0.0      0     0 ?        I    16:08   0:00 [kworker/11:0-mm_percpu_wq]
root      255892  0.0  0.0      0     0 ?        I    16:12   0:00 [kworker/13:2-events]
root      257535  0.0  0.0      0     0 ?        I    16:12   0:00 [kworker/14:0-events]
root      258334  0.0  0.0      0     0 ?        I    16:13   0:01 [kworker/u32:2-flush-252:0]
root      277994  0.0  0.0      0     0 ?        I    16:16   0:00 [kworker/2:1-events]
root      285494  0.0  0.0      0     0 ?        I    16:18   0:00 [kworker/14:1-events]
root      318841  0.0  0.0      0     0 ?        I    16:20   0:00 [kworker/3:1-cgroup_release]
root      319712  0.0  0.0      0     0 ?        I    16:20   0:00 [kworker/10:0-inet_frag_wq]
root      319799  0.0  0.0      0     0 ?        I    16:20   0:00 [kworker/6:2-events]
root      320360  0.0  0.0      0     0 ?        I    16:20   0:00 [kworker/12:0-events]
root      325317  0.0  0.0      0     0 ?        I    16:20   0:00 [kworker/9:0-mld]
root      344109  0.0  0.0      0     0 ?        I    16:24   0:00 [kworker/u32:0-ext4-rsv-conversion]
root      344110  0.0  0.0      0     0 ?        I    16:24   0:00 [kworker/u32:5-loop2]
root      344111  0.0  0.0      0     0 ?        I    16:24   0:00 [kworker/u32:7-ext4-rsv-conversion]
root      345292  0.0  0.0      0     0 ?        I    16:25   0:00 [kworker/14:2-events]
root      358538  0.0  0.0      0     0 ?        I    16:27   0:00 [kworker/8:1-events]
root      361031  0.0  0.0      0     0 ?        I    16:28   0:00 [kworker/12:1-events]
root      361385  0.0  0.0      0     0 ?        I    16:28   0:00 [kworker/9:2-cgroup_release]
root      364844  0.0  0.0      0     0 ?        I    16:29   0:00 [kworker/4:0-cgroup_release]
root      370312  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/15:1-events]
root      370320  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/5:1-ipv6_addrconf]
root      370756  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/3:2-events]
root      370772  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/10:2-cgroup_release]
root      370819  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/14:3-events]
root      370841  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/14:4-events]
root      372533  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/13:1-cgroup_release]
root      372561  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/11:1-events]
root      372604  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/5:3-events]
root      372607  0.0  0.0      0     0 ?        I    16:30   0:00 [kworker/4:4-cgroup_release]
root      376308  0.0  0.0      0     0 ?        I    16:31   0:00 [kworker/1:1-events]
root      376765  0.0  0.0      0     0 ?        I    16:31   0:00 [kworker/2:0-rcu_gp]
root      376997  0.0  0.0      0     0 ?        I    16:31   0:00 [kworker/15:2-rcu_gp]
root      379987  0.0  0.0      0     0 ?        I    16:32   0:00 [kworker/6:3-events]
root      380180  0.0  0.0      0     0 ?        I    16:32   0:00 [kworker/1:2-events]
root      383169  0.0  0.0      0     0 ?        I    16:32   0:00 [kworker/0:2-events]
root      383437  0.0  0.0      0     0 ?        I    16:33   0:00 [kworker/8:2-events]
root      385033  0.0  0.0      0     0 ?        I    16:33   0:00 [kworker/9:1-events]
root      385573  0.0  0.0      0     0 ?        Z    16:33   0:00 [/var/lib/openst] <defunct>
root      388435  0.0  0.0      0     0 ?        I    16:34   0:00 [kworker/7:2-cgroup_free]
root      388449  0.0  0.0      0     0 ?        I    16:34   0:00 [kworker/0:3-inet_frag_wq]
root      391479  0.0  0.0      0     0 ?        Z    16:34   0:00 [/var/lib/openst] <defunct>
root      393774  0.2  0.0      0     0 ?        I    16:35   0:00 [kworker/u32:8-flush-252:0]
root      393818  0.0  0.0      0     0 ?        I    16:35   0:00 [kworker/9:3-events]
root      393944  0.0  0.0      0     0 ?        I    16:35   0:00 [kworker/14:5-events]
root      395979  0.0  0.0      0     0 ?        I    16:35   0:00 [kworker/10:1-events]
root      397975  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/4:1-cgroup_free]
root      398736  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/5:2-events]
root      400373  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/4:2-events]
root      400475  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/13:0-events]
root      400490  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/3:0-events]
root      400659  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/13:3-events]
root      400766  0.0  0.0      0     0 ?        I    16:36   0:00 [kworker/2:2-dio/vda1]
root      401228  0.0  0.0      0     0 ?        I    16:37   0:00 [kworker/12:2-events]
root      401272  0.0  0.0      0     0 ?        I    16:37   0:00 [kworker/15:0-events]
root      402810  0.0  0.0      0     0 ?        I    16:37   0:00 [kworker/1:0-events]
root      403527  0.0  0.0      0     0 ?        I    16:37   0:00 [kworker/3:3-events]
root      404017  0.0  0.0      0     0 ?        I    16:37   0:00 [kworker/10:3-events]
root      404782  0.0  0.0      0     0 ?        I    16:38   0:00 [kworker/8:0-events]
root      405372  0.0  0.0      0     0 ?        I    16:38   0:00 [kworker/1:3]
root      405373  0.0  0.0      0     0 ?        I    16:38   0:00 [kworker/1:4-rcu_gp]
root      408379  0.0  0.0      0     0 ?        I    16:39   0:00 [kworker/7:0-events]
root      408488  0.0  0.0      0     0 ?        I    16:39   0:00 [kworker/12:3-events]
root      408507  0.0  0.0      0     0 ?        I    16:39   0:00 [kworker/0:0-events]